SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|218884171|ref|YP_002428553.1| from Desulfurococcus kamchatkensis 1221n

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|218884171|ref|YP_002428553.1|
Domain Number 1 Region: 132-265
Classification Level Classification E-value
Superfamily Translational machinery components 1.13e-38
Family ERF1/Dom34 middle domain-like 0.0011
Further Details:      
 
Domain Number 2 Region: 3-129
Classification Level Classification E-value
Superfamily N-terminal domain of eukaryotic peptide chain release factor subunit 1, ERF1 6.28e-36
Family N-terminal domain of eukaryotic peptide chain release factor subunit 1, ERF1 0.00053
Further Details:      
 
Domain Number 3 Region: 268-362
Classification Level Classification E-value
Superfamily L30e-like 1.29e-23
Family ERF1/Dom34 C-terminal domain-like 0.0053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|218884171|ref|YP_002428553.1|
Sequence length 363
Comment peptide chain release factor 1 [Desulfurococcus kamchatkensis 1221n]
Sequence
MRVDKQRLREIIKELKKWKAHATILLSLYVPPGRPIGDVLNLLRQELSVADNIKLKKTRN
AVERALSIAIERMSKIPKVPDKGLVLFAGEDPDTGKSITVMLIPPEEVPVFFYRTDKVFH
TEFLEEMVSESNIIGLLIVERDAATIGLLKGNRLQVVEELEDYIPGKHQKGGQSQRRYDR
IIEQMVEDFYKRVGEHANNVFLPLLEQGKLKALLVGGPAYAKYDFMEKDYLDYRLKKIVL
PEFIDVAYQGEPGLREMIMRAGDLLKEQEYAETLKAIEEFKYHLAKDDGLIVYGEEEVRN
ALEMGLVGILLISEQREDIEEWLELARKRGAKPLVVSTDIPEGEWFAQTFNGLAGILRTR
VSW
Download sequence
Identical sequences B8D505
490899.DKAM_0860 WP_012608527.1.40753 gi|218884171|ref|YP_002428553.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]