SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|218884226|ref|YP_002428608.1| from Desulfurococcus kamchatkensis 1221n

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|218884226|ref|YP_002428608.1|
Domain Number 1 Region: 141-361
Classification Level Classification E-value
Superfamily Creatinase/aminopeptidase 1.7e-68
Family Creatinase/aminopeptidase 0.00000929
Further Details:      
 
Domain Number 2 Region: 5-140
Classification Level Classification E-value
Superfamily Creatinase/prolidase N-terminal domain 0.000000000698
Family Creatinase/prolidase N-terminal domain 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|218884226|ref|YP_002428608.1|
Sequence length 368
Comment peptidase M24 [Desulfurococcus kamchatkensis 1221n]
Sequence
MSRELRIGKLVSLMESHGLQDIVLVSPENIEYYTGVETVADATLLLHATRGGGVSIYVPL
LEYYRYRDSLPGEVEVYAYSKTLKPSDARIVEKDYREILKEIIDKSSKIGIDKQLQDTPI
QQETHSDRVVDISGDVWKHRMIKDEKEIEAIRKAVDITIKGIKTIQDNISEGVTEAELAG
FFEERVRREGVKKYAFDPIIAFKPGNSYPHILPGSKKLGRRDLVLIDVGVKYRGRCSDLT
RMITWGRPTPDERRSLEAVEEALWESIDSIYPGIKAGDVAEKAVKKLEKYGLHERFIHGL
GHGIGIAVHEPPYLRLGGSTLLEPGMVFTIEPGVYFNGRYGVRMEEDVLVTRKGVRVLSR
RLKPLLML
Download sequence
Identical sequences B8D560
gi|218884226|ref|YP_002428608.1| 490899.DKAM_0915 WP_012608582.1.40753

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]