SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|218884287|ref|YP_002428669.1| from Desulfurococcus kamchatkensis 1221n

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|218884287|ref|YP_002428669.1|
Domain Number 1 Region: 2-120
Classification Level Classification E-value
Superfamily Riboflavin kinase-like 1.47e-32
Family CTP-dependent riboflavin kinase-like 0.00059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|218884287|ref|YP_002428669.1|
Sequence length 122
Comment Riboflavin kinase [Desulfurococcus kamchatkensis 1221n]
Sequence
MHRLKGRIVTGLGEGSRYVYQYRDRFLRIIGINPYPGTLNIELIEPRFFNIEDYKYIEVD
PPSQVYGKVLAVKARIKNIPVYIIKPLKTRHALNIIEVISEHNLRESLGVKTGDVVEIYV
ED
Download sequence
Identical sequences B8D5C1
490899.DKAM_0976 WP_012608643.1.40753 gi|218884287|ref|YP_002428669.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]