SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|218884289|ref|YP_002428671.1| from Desulfurococcus kamchatkensis 1221n

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|218884289|ref|YP_002428671.1|
Domain Number 1 Region: 8-165
Classification Level Classification E-value
Superfamily Bacterial fluorinating enzyme, N-terminal domain 6.67e-63
Family Bacterial fluorinating enzyme, N-terminal domain 0.00019
Further Details:      
 
Domain Number 2 Region: 171-266
Classification Level Classification E-value
Superfamily Bacterial fluorinating enzyme, C-terminal domain 8.11e-22
Family Bacterial fluorinating enzyme, C-terminal domain 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|218884289|ref|YP_002428671.1|
Sequence length 272
Comment hypothetical protein DKAM_0978 [Desulfurococcus kamchatkensis 1221n]
Sequence
MVGTMSNRIIALMTDFGYKDPYVGVMKGVIKSINPDVEIVDLTHGINRHDIIEAAVVLMV
SARYFPPGTIFVVVVDPGVGSNRRAIVVETSNYILVGPDNGCLSLLALKDGVKRVVDISN
SRYRLGDVSHTFHGRDIFAPVAAWISRGIPLEAIGTEIPVDSLKTIRIEPPRISDDLIEG
YALYIDIYGNVMTNINEDEACSILKLGDKVEIIHQGGKSQCVFTTSFSIVNPGEVACYIN
SWGYLEIAVNNGSAADVFGIIQGSRLFFKKLS
Download sequence
Identical sequences B8D5C3
gi|218884289|ref|YP_002428671.1| 490899.DKAM_0978 WP_012608645.1.40753

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]