SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|218884305|ref|YP_002428687.1| from Desulfurococcus kamchatkensis 1221n

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|218884305|ref|YP_002428687.1|
Domain Number 1 Region: 81-191
Classification Level Classification E-value
Superfamily V-type ATPase subunit E-like 0.0000000000000484
Family V-type ATPase subunit E 0.0018
Further Details:      
 
Weak hits

Sequence:  gi|218884305|ref|YP_002428687.1|
Domain Number - Region: 12-72
Classification Level Classification E-value
Superfamily F1F0 ATP synthase subunit B, membrane domain 0.00876
Family F1F0 ATP synthase subunit B, membrane domain 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|218884305|ref|YP_002428687.1|
Sequence length 191
Comment V-type ATPase subunit E [Desulfurococcus kamchatkensis 1221n]
Sequence
MALESEAIKARLLEEARARAEEIVKEAEKEAERKIREAEALWREKAEKERMRIISEAEKE
ANNIVSDAVREARFIISMEVDNIISDILNQAYSVIRSRGFDVKASLKNLITESMKVIDSP
RRLIVSRRDLETAREVVTELGLTGVSIEVGNIEGGIIVESASGIIVDNTYESRFKEFQNK
YLNEVRRILWG
Download sequence
Identical sequences B8D5D9
490899.DKAM_0994 gi|218884305|ref|YP_002428687.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]