SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|218884322|ref|YP_002428704.1| from Desulfurococcus kamchatkensis 1221n

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|218884322|ref|YP_002428704.1|
Domain Number 1 Region: 27-167
Classification Level Classification E-value
Superfamily Acid phosphatase/Vanadium-dependent haloperoxidase 1.09e-26
Family Haloperoxidase (bromoperoxidase) 0.067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|218884322|ref|YP_002428704.1|
Sequence length 293
Comment PA-phosphatase-like phosphoesterase [Desulfurococcus kamchatkensis 1221n]
Sequence
MILLQGLNNRFKVLLDAVIAIALASTILLNNTGVWRMWSILGEEYIYLFTCILLYYIVDP
YTGLYTVLAVIASGSLNLVMKYSFNTPRPPNPLVEAEGPGFPSGHAQISTSFWGTLTLKL
GDKYLSVASALLVAGISLSRIYLRAHYVVDVAGGITAGLAIALIIYYLGSKLEPGSASIT
IGAAAIALSSTTLLLRQWEPTALGLTGIGIALVASGRRIKDVIEALNTMDMRHRIKALIL
VLIATGPLYLAARTGGVARIIFFTIIGLTIFNTPLILGKRTRSRNTNSGAAGI
Download sequence
Identical sequences B8D5F6
gi|218884322|ref|YP_002428704.1| 490899.DKAM_1011 WP_012608678.1.40753

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]