SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|218884341|ref|YP_002428723.1| from Desulfurococcus kamchatkensis 1221n

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|218884341|ref|YP_002428723.1|
Domain Number 1 Region: 2-94
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.000000472
Family Thioltransferase 0.075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|218884341|ref|YP_002428723.1|
Sequence length 116
Comment hypothetical protein DKAM_1030 [Desulfurococcus kamchatkensis 1221n]
Sequence
MYELRSREELTRAIIGNEVVFIEYYIPNNRDSENLTAAVKSLEEDGDSRILFCRINMTEY
PELVETPRGIPYVEVYYMGKRVFEHYGSLSTADLNLQVLRRGLRQVFRELNISLRI
Download sequence
Identical sequences B8D5H5
gi|218884341|ref|YP_002428723.1| 490899.DKAM_1030 WP_012608697.1.1384 WP_012608697.1.40753

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]