SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|218884349|ref|YP_002428731.1| from Desulfurococcus kamchatkensis 1221n

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|218884349|ref|YP_002428731.1|
Domain Number 1 Region: 7-174
Classification Level Classification E-value
Superfamily Inorganic pyrophosphatase 1.57e-68
Family Inorganic pyrophosphatase 0.000000553
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|218884349|ref|YP_002428731.1|
Sequence length 175
Comment inorganic pyrophosphatase [Desulfurococcus kamchatkensis 1221n]
Sequence
MSQYSKLGPGSKAPEEVYVVIEIPVNSGVKYELDKETGVLMVDRILYTSMVYPFNYGFIP
GTLEEDGDPVDVLVVSSEPLIPGSVIKVRPIGVLETEDEKGRDAKILAVPVDKVDPRYSN
IRDVGDLPEAVKQRIKHFFEHYKELEPGKWVKVVGWKGREEALKRINDAINRAKG
Download sequence
Identical sequences B8D5I3
gi|218884349|ref|YP_002428731.1| WP_012608705.1.1384 WP_012608705.1.40753 490899.DKAM_1038

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]