SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|218884480|ref|YP_002428862.1| from Desulfurococcus kamchatkensis 1221n

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|218884480|ref|YP_002428862.1|
Domain Number 1 Region: 90-189
Classification Level Classification E-value
Superfamily Ribosomal protein S3 C-terminal domain 1.03e-24
Family Ribosomal protein S3 C-terminal domain 0.00097
Further Details:      
 
Domain Number 2 Region: 10-98
Classification Level Classification E-value
Superfamily Prokaryotic type KH domain (KH-domain type II) 9.16e-22
Family Prokaryotic type KH domain (KH-domain type II) 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|218884480|ref|YP_002428862.1|
Sequence length 223
Comment 30S ribosomal protein S3P [Desulfurococcus kamchatkensis 1221n]
Sequence
MVGPRVKSYFLEYGLKKLMIDEFLAHYFKDAGYADVELYRTPTGYRVVIHAEYPGRLIGR
GGSVIKKLSTILQNKFGLDNVNITISPVIDPDLNARVVAFRIVRALEKEIPFRRVMMYML
KRVMDAGAIGAEIIISGKLRGERATYEKLKAGKVYKAGEPVEYMVDRAVVKALLKPGIFG
VEVVIVKPGIKMPDHVEIKTLKPEELEALKPAKTTEGGGSEGK
Download sequence
Identical sequences B8D5W4
WP_012608836.1.40753 gi|218884480|ref|YP_002428862.1| 490899.DKAM_1169

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]