SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|218884501|ref|YP_002428883.1| from Desulfurococcus kamchatkensis 1221n

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|218884501|ref|YP_002428883.1|
Domain Number 1 Region: 1-79
Classification Level Classification E-value
Superfamily all-alpha NTP pyrophosphatases 1.1e-19
Family MazG-like 0.00035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|218884501|ref|YP_002428883.1|
Sequence length 85
Comment MazG nucleotide pyrophosphohydrolase [Desulfurococcus kamchatkensis 1221n]
Sequence
MDIKSAQDYIRRQYYERDNARGVFATFTWFTEEVGELAEALLHMDKSMLEEELADVFAWL
LSIANLVNIDLEEAFRKKYLSPGTS
Download sequence
Identical sequences B8D5Y5
gi|218884501|ref|YP_002428883.1| WP_012608857.1.1384 WP_012608857.1.40753 490899.DKAM_1190

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]