SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|218884545|ref|YP_002428927.1| from Desulfurococcus kamchatkensis 1221n

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|218884545|ref|YP_002428927.1|
Domain Number 1 Region: 9-89
Classification Level Classification E-value
Superfamily AlbA-like 0.00000000000000183
Family DNA-binding protein AlbA 0.00069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|218884545|ref|YP_002428927.1|
Sequence length 91
Comment DNA/RNA-binding protein Alba 2 [Desulfurococcus kamchatkensis 1221n]
Sequence
MVKHVDSVRILNIGKKPLEDYIVEVILMFQEGSDKLVLKGVGPNISRAVDLYNMLVSRMG
SSIELVNIGIGSEKVRGRIKPYIVIEIRRKY
Download sequence
Identical sequences B8D629
490899.DKAM_1234 gi|218884545|ref|YP_002428927.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]