SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|218884674|ref|YP_002429056.1| from Desulfurococcus kamchatkensis 1221n

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|218884674|ref|YP_002429056.1|
Domain Number 1 Region: 37-162
Classification Level Classification E-value
Superfamily Insert subdomain of RNA polymerase alpha subunit 2.79e-33
Family Insert subdomain of RNA polymerase alpha subunit 0.00026
Further Details:      
 
Domain Number 2 Region: 2-42,190-274
Classification Level Classification E-value
Superfamily RBP11-like subunits of RNA polymerase 1.96e-25
Family RNA polymerase alpha subunit dimerisation domain 0.019
Further Details:      
 
Weak hits

Sequence:  gi|218884674|ref|YP_002429056.1|
Domain Number - Region: 164-199
Classification Level Classification E-value
Superfamily alpha-helical ferredoxin 0.0246
Family Fumarate reductase/Succinate dehydogenase iron-sulfur protein, C-terminal domain 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|218884674|ref|YP_002429056.1|
Sequence length 280
Comment DNA-directed RNA polymerase subunit D [Desulfurococcus kamchatkensis 1221n]
Sequence
MHIDILEKTPSTIKLYLRDVPLHLVNSLRRTILSEVPTMAVDYVAITENSSVFYDEYISH
RLGLIPLKSNEALNKYKPPEECAEAGDRGIFSQDCFVTLRLEASGPEKDVLTVYSRDLVS
SDPDVVPVYGEIPILKLIKDQSIRLEAYARLGRGKEHIKWSPVSTAAHKYVPAITIDSEK
CKGAECSRCVNACPKNIFEAGNNSVRVKEDKILECTFCRLCENICPTQAVKVSWRENEYI
LYLELTGALNARNILIEAINILSRKLDAFIDELRRNGVAV
Download sequence
Identical sequences B8D6F8
490899.DKAM_1363 gi|218884674|ref|YP_002429056.1| WP_012609030.1.40753

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]