SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|218884712|ref|YP_002429094.1| from Desulfurococcus kamchatkensis 1221n

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|218884712|ref|YP_002429094.1|
Domain Number 1 Region: 6-258
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 2.88e-62
Family Tyrosine-dependent oxidoreductases 0.0000991
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|218884712|ref|YP_002429094.1|
Sequence length 262
Comment short-chain dehydrogenase/reductase SDR [Desulfurococcus kamchatkensis 1221n]
Sequence
MGIVEGLRVLVTASTRGLGRGAAEALLEEGAKVVINGRSRDNVEKTLGELKSRFGDRVHG
VAADLTVRGDVYRLVDEAVKFLGGLDSIIYITGPPRPGTFQEIREDEWEYNARLLVFNAI
WIVNASLPYLRKSSNPSIIFSTSLAVKEPIDILALSNVLRLSIHGLVKTLAKELGREGIR
VNAVMPGYIETDRIRKLIEDRARRGNKSYEEAYREFVSDIPLGRLGSPIEYGRVIVFLAS
RYASYLNGVSIPIDGGLMKSIF
Download sequence
Identical sequences B8D6J6
WP_012609068.1.40753 490899.DKAM_1401 gi|218884712|ref|YP_002429094.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]