SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|218884344|ref|YP_002428726.1| from Desulfurococcus kamchatkensis 1221n

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|218884344|ref|YP_002428726.1|
Domain Number 1 Region: 16-145,407-527
Classification Level Classification E-value
Superfamily GroEL equatorial domain-like 7.59e-90
Family Group II chaperonin (CCT, TRIC), ATPase domain 0.0000205
Further Details:      
 
Domain Number 2 Region: 214-380
Classification Level Classification E-value
Superfamily GroEL apical domain-like 9.16e-59
Family Group II chaperonin (CCT, TRIC), apical domain 0.00000189
Further Details:      
 
Domain Number 3 Region: 147-218,370-406
Classification Level Classification E-value
Superfamily GroEL-intermediate domain like 2.62e-25
Family Group II chaperonin (CCT, TRIC), intermediate domain 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|218884344|ref|YP_002428726.1|
Sequence length 549
Comment Thermosome subunit alpha [Desulfurococcus kamchatkensis 1221n]
Sequence
MALYGVPVLVLKEGTRRTVGRDALRANIAAARALAEVLRTSLGPRGLDKMLVDSFGDVTV
TNDGATIVKEMEVQHPAAKLLVEVAKAQDAEVGDGTTSAVVLAGTLLAKAEELLDQNIHP
SIIIEGYTKAMKEALRLLDEISVKVNPRDKDMLRRIVNTTISSKYIGGDIISKKIAEIAI
DAALAVAEPKPDGTYDFRVDDVKIEKKKGGNVLDTQLVYGIVLDKEVVHPGMPRRVENAR
IALLDAALEIEKPEITAKINITSPELIKAFLDKEAEMLKEMVDKIASVGANVVVCQKGID
EVAQHFLAKKGILAVRRAKRSDLEKLERATGGRIVSSVRDLKPEDLGYAALVEERRIGND
KMVFIEGCKNPKAVTILVRGASDMVMDEIERSLKDALNVLRNIMRTPKIVPGGGAVEIEL
AMKLREYASKIGGKEQLAIEAFASALEEIPLILTETSGKEPLDILMKLRQLHSEGKKYAG
INAVTGEIIEDIITNNIIEPLLVKESMIKTAAEAAVTILKIDDVIAASPVKKEKEGKKEG
EESKMPSFD
Download sequence
Identical sequences B8D5H8
WP_012608700.1.40753 gi|218884344|ref|YP_002428726.1| 490899.DKAM_1033

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]