SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|218884572|ref|YP_002428954.1| from Desulfurococcus kamchatkensis 1221n

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|218884572|ref|YP_002428954.1|
Domain Number 1 Region: 18-147,406-526
Classification Level Classification E-value
Superfamily GroEL equatorial domain-like 3.14e-87
Family Group II chaperonin (CCT, TRIC), ATPase domain 0.00000935
Further Details:      
 
Domain Number 2 Region: 213-379
Classification Level Classification E-value
Superfamily GroEL apical domain-like 1.15e-62
Family Group II chaperonin (CCT, TRIC), apical domain 0.00000332
Further Details:      
 
Domain Number 3 Region: 148-217,369-405
Classification Level Classification E-value
Superfamily GroEL-intermediate domain like 5.19e-28
Family Group II chaperonin (CCT, TRIC), intermediate domain 0.00088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|218884572|ref|YP_002428954.1|
Sequence length 549
Comment Thermosome subunit beta [Desulfurococcus kamchatkensis 1221n]
Sequence
MTAEPTGIPVLILKEGTQRTTGRDALRSNLLAARAIAEMIKTTYGPKGMDKMLVDALGDV
TITNDGATILDKAEIQHPAAKMLVQVAKSQDSEVGDGTKRAVIFAGELLRYAEELLDKNI
HPTVIISGYRIAMEEALKVLDQIAEPIDINSEELLKKVARTSLTSKAVHDAREFFADIAV
KAVKQVVEKRGDKYYVDLDNIQIIKKYGGALLDSMLVYGIVLDKEVVHPGMPRRVENARI
VLLDAPLEIEKPEIDAEIRINDPEQLEKFLQQEEDILVKMVDKIASVGANVVVCQKGIDE
VAQHFLAKKGILAVRRVKRSDLEKLERATGGRIVSNIEDLTPEDLGYAALVEERKIGEDK
MVFIEGCKNPRSVSIVIRGGLERLVDEAERSMRDALSAVADALRDGKIIPGGGATEIELA
KYIRRLATKIGGKEQLAIEAFAKAIEGLTVSLIENAGLDPIDMIMKLRAAHEKDSGKYLS
IDLATGDLVNMKEKGVIEPVSILANAIKAGTEAATIILRIDDVIAASKLEKGKEETGKKP
GEEEKEKED
Download sequence
Identical sequences B8D656
gi|218884572|ref|YP_002428954.1| 490899.DKAM_1261 WP_012608928.1.40753

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]