SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000000936 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000000936
Domain Number 1 Region: 9-132
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.76e-24
Family Ankyrin repeat 0.00087
Further Details:      
 
Domain Number 2 Region: 358-403
Classification Level Classification E-value
Superfamily LEM domain 0.0000000902
Family LEM domain 0.0067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000000936   Gene: ENSFCAG00000001003   Transcript: ENSFCAT00000001003
Sequence length 614
Comment pep:known_by_projection chromosome:Felis_catus_6.2:A2:12477797:12481797:1 gene:ENSFCAG00000001003 transcript:ENSFCAT00000001003 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAVAAGLARRLRAALREEEPRAVEELLRRGADPNLVLADGVAAMHLAARARHSRGLRCLE
ALLHRGGDANARSVEALTPLHVAAAWGCRRGLELLLGHGADPTLRDQDGLGPLDLAEQQG
HQDCAHVLRELQTRTKTSTRTRAESQEPEPEPEPGASGLPNVTLGFIALGRSDGRDTGLE
AGPRLPRHLARPEIADKDSSLEYPPGQWDCSSDASFVTAIEASGTEDPAPHTSSWARSSP
QTKQRLMPTIRPSQRTPRSPGTPQLVHRAAAADREAELNTCLQALTLTSPDASPSPLALP
DGSPAQSPPREPLPGLPHVHFLKDEELSPDSDVAALWLTEDEASSTGGRDPAPSHWCPPV
PAMTDLEILRGLRALGKNPGPITPFTQTYHLRRLEEARAAPGSDFSGHSPELAEALRTGC
IPDAQADEDVLAQQFERPDPKRRWREGVVKSSFTYLLLDPRETQDLPGRAFSLTPAERLR
TFVHAIFYVGKGTRARPDVHLWEALSHRRQPRKQACPKVRQILDIWASGRGVVSLHCFQH
VVAVEAYTREACLVDALGIQTLTNQRQGHCYGVVASWPPTRRRRLGVHLLHRALLVFLAE
GERELRPQDIQARG
Download sequence
Identical sequences ENSFCAP00000000936

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]