SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000000941 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000000941
Domain Number 1 Region: 157-259,427-498
Classification Level Classification E-value
Superfamily TrmE connector domain 4.84e-42
Family TrmE connector domain 0.0033
Further Details:      
 
Domain Number 2 Region: 108-188,227-417
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.72e-36
Family G proteins 0.00039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000000941   Gene: ENSFCAG00000001008   Transcript: ENSFCAT00000001008
Sequence length 498
Comment pep:known_by_projection chromosome:Felis_catus_6.2:A2:12516089:12519584:1 gene:ENSFCAG00000001008 transcript:ENSFCAT00000001008 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWRGLWTLVARAARGPRSPRPCTRQGSGVSVPGSGATIFALSSGHGRCGIAVIRTSGPAS
GHALRSLTAPRDLPPARSACLRLLSHPRSGEPLDRALVLWFPALGPQSFTGEDCAEFHVH
GGPAVVSGVLQALGCVPGLRPAEAGEFTRRAFAHGKLSLTEVEGLADLIHAETEAQRRQA
LRQLDGELGHLCHGWARTLTKALAHVEAYIDFGEDDNLEEGVLEQATANSEVRELQLALG
AHLRDARRGQRLRSGAHVVVAGPPNAGKSSLVNLLSRKPVSIVSPEPGTTRDVLETPVDL
AGFPALLSDTAGLREGAGPVEQEGVRRARERLEQADLVLAVLDASDLASPSSCNFLDTVV
APAGAGSPNGNSQRLLLVLNKSDLLPPGGPDPSPNLRPHLLLSCLTGEGLDGLLEALRKE
LAQVCGDPSTGPPLLTRARHQHHLQGCLDALGHYTQTKDLALAAEALRLARGHLARITGG
GGTEEILDIIFRDFCVGK
Download sequence
Identical sequences ENSFCAP00000000941

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]