SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000002304 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000002304
Domain Number 1 Region: 5-57
Classification Level Classification E-value
Superfamily LEM domain 0.0000000000182
Family LEM domain 0.0029
Further Details:      
 
Domain Number 2 Region: 280-324,352-408
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.000000047
Family Ankyrin repeat 0.0055
Further Details:      
 
Weak hits

Sequence:  ENSFCAP00000002304
Domain Number - Region: 160-195
Classification Level Classification E-value
Superfamily L9 N-domain-like 0.033
Family N-terminal domain of RNase HI 0.0097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000002304   Gene: ENSFCAG00000002504   Transcript: ENSFCAT00000002504
Sequence length 889
Comment pep:known_by_projection chromosome:Felis_catus_6.2:D3:543026:559871:1 gene:ENSFCAG00000002504 transcript:ENSFCAT00000002504 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GEMTMDAILARLKLLNPDDLREEIVKAGLKCGPITSTTRFIFEKKLAQALLEHGRTLPSQ
PPGHDMSGATTISQDTQRNWKSAVGSQPEQVGLSEDRDFGYSVGLNPPEEDVVMSKTCSL
SFGAATGVNGHKAMVTASAGPPLYYGVCPAYEDIPARNERIHVYEDKKEALQAVRMIKGS
RFKAFSSREDAEKFARGLCDYFPSPSKASSALSPVKTAPLMSSGGLKDGLYPPESETVNK
ERANSYKTPRTQDLTAKLRKAVEKGEDDTFSDLTWSNPRYLIGSGDNPTIVQEGCRYNVM
HVAAKENQASICQLTLETLENPEFMRLMYPDDDQNMLQQRIYYIVDLYLNTPDKVGYDTP
LHFACKFGNADVVNVLSSHPLIVKNPRNKYDKTPEDVICERSKNKSVELKERIREYLKGH
YYVPLLRAEDTSSPVIGELWSSDQMTETSHVSHGGGGPRDPVLTLRAFAGPLSPSKAEDF
RRLWKTPPREKAGFFHSVRKTDPERGVERVGRELAHELGYPWVEYWDFLGCFVDLSSQEG
LQKLEEYLAPQEVRNDAQESGENEASHQDASVSGRRKCSNSISVRAFLDEDDELSLEEIK
NRQNTARNNTRPTLGTFGDLECDILPLEQETELIEASTLTSAHSSKNGFCSPLSGGQTLG
RRRTEAPHGEEALLSPVPGLTVEFDKLNLQDLGSNFSKTPNKNMKTAGRRSPTSRTDAVE
RDLLEPSAADALTNEQMRTENEMSARIAKIRLGLDAPGHEAQQSYRKEPIQRLFLLGREE
PSKLDRDVLAALEGTDVDPQRYPAVHRWKSAVLCFSPSDRQSWPSPALKGRLECRQPDLG
GPHSCSPGRSPGKPGPTPHSPGLGSPGRYSPAGGGRLRRMARLAQLTAL
Download sequence
Identical sequences ENSFCAP00000002304

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]