SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000006785 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000006785
Domain Number 1 Region: 4-139
Classification Level Classification E-value
Superfamily Eukaryotic RPB5 N-terminal domain 6.41e-46
Family Eukaryotic RPB5 N-terminal domain 0.00023
Further Details:      
 
Domain Number 2 Region: 136-190
Classification Level Classification E-value
Superfamily RPB5-like RNA polymerase subunit 6.93e-19
Family RPB5 0.00036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000006785   Gene: ENSFCAG00000007318   Transcript: ENSFCAT00000007320
Sequence length 190
Comment pep:known_by_projection chromosome:Felis_catus_6.2:A2:392528:550593:-1 gene:ENSFCAG00000007318 transcript:ENSFCAT00000007320 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AMDDEEETYRLWKIRKTIMQLCHDRGYLVTQDELDQTLEEFKAQFGDKPSEGRPRRTDLT
VLVAHNDDPTDQMFVFFPEEPKVGIKTIKVYCQRMQEENITRALIVVQQGMTPSAKQSLV
DMAPKYVLEQFLQQELLINITEHELVPEHVVMTKEEVTELLARYKLRENQLPRIQAGDPV
ARYFGIKRGQ
Download sequence
Identical sequences ENSFCAP00000006785

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]