SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000010720 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000010720
Domain Number 1 Region: 88-279
Classification Level Classification E-value
Superfamily Cytochrome c 8.98e-75
Family Cytochrome bc1 domain 0.00000000627
Further Details:      
 
Domain Number 2 Region: 280-325
Classification Level Classification E-value
Superfamily Cytochrome c1 subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase), transmembrane anchor 5.23e-16
Family Cytochrome c1 subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase), transmembrane anchor 0.000099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000010720   Gene: ENSFCAG00000011545   Transcript: ENSFCAT00000011548
Sequence length 325
Comment pep:known_by_projection chromosome:Felis_catus_6.2:F2:82084668:82087188:1 gene:ENSFCAG00000011545 transcript:ENSFCAT00000011548 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VAXXXXXXXGAVLGPRGAGLPGARARSLLCGARPCQLPLRTPQAVSLSSKAGLSRGRKVM
LSALGMLAAGGAGLAVALHSAVSASDLELHPPSYPWSHRGFLSSLDHTSIRRGFQVYKQV
CSSCHSMDYVAYRHLVGVCYTEDEAKALAEEVEVQDGPNEDGEMFMRPGKLSDYFPKPYP
NPEAARAANNGALPPDLSYIVRARHGGEDYVFSLLTGYCEPPTGVSLREGLYFNPYFPGQ
AIGMAPPIYTEVLEYDDGTPATMSQVAKDVCTFLRWASEPEHDHRKRMGLKMLMMMGLLL
PLVYAMKRHKWSVLKSRKLAYRPPK
Download sequence
Identical sequences ENSFCAP00000010720

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]