SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000012585 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000012585
Domain Number 1 Region: 11-104
Classification Level Classification E-value
Superfamily Pre-PUA domain 2.09e-42
Family Nip7p homolog, N-terminal domain 0.00000193
Further Details:      
 
Domain Number 2 Region: 105-180
Classification Level Classification E-value
Superfamily PUA domain-like 2.76e-26
Family PUA domain 0.0000147
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000012585   Gene: ENSFCAG00000013574   Transcript: ENSFCAT00000013578
Sequence length 190
Comment pep:known_by_projection chromosome:Felis_catus_6.2:E2:46800431:46802414:1 gene:ENSFCAG00000013574 transcript:ENSFCAT00000013578 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ADSVLQPSGKMRPLTEEETRVMFEKIAKYIGENLQLLVDRPDGTYCYRLHNDRVYYVSEK
ILKLAANISGDKLVSLGTCFGKFTKTHKFRLHITALDYLAPYAKYKVWIKPGAEQSFLYG
NHVLKSGLGRITENTCQYQGVVVYSMADVPLGFGVAAKSTQDCRKVDPMAIVVFHQADIG
EYVRHEETLT
Download sequence
Identical sequences ENSFCAP00000012585

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]