SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000014605 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000014605
Domain Number 1 Region: 352-712
Classification Level Classification E-value
Superfamily Urocanase 4.45e-129
Family Urocanase 0.00000159
Further Details:      
 
Domain Number 2 Region: 96-313
Classification Level Classification E-value
Superfamily Urocanase 3.14e-90
Family Urocanase 0.00000816
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000014605   Gene: ENSFCAG00000015746   Transcript: ENSFCAT00000015750
Sequence length 737
Comment pep:known_by_projection chromosome:Felis_catus_6.2:A2:58110829:58150715:1 gene:ENSFCAG00000015746 transcript:ENSFCAT00000015750 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QSWPPSQSQPNMSSLQVLCSGLPLRPLPENRGRWAGVPHAPVRTPGLSPAEEQLALRNAL
RYFPPDVQELLAPEFAQELRLYGHIYMYRFCPDIKMRAYPIEQYPCRTRAAAAIMHMIMN
NLDPAVAQFPQELVTYGGNGQVFSNWAQFWLTMSYLSQMTEEQTLVMYSGHPLGLFPSSP
GAPRLVITNGMVIPNYSSRTEYEKLFAMGVTMYGQMTAGSYCYIGPQGIVHGTVLTVLNA
GRRYLGVKDLAGKVFVTSGLGGMSGAQAKAAVIVGCIGVIAEVDKAALMKRHQQGWLMEV
TDSLDHCIERLRGLGRPQKGSGGWAAVCGPVKCLILSHTFSPAWYWWGRCNGPSALLLSP
SREARKRKEVLSLGYHGNVVDLWERLVHELDTTGELLVDLGSDQTSCHNPFNGGYYPVQL
GFAEAQSLMASDPAAFKSLVQESLRRQVSAINRLAKENFFFWDYGNAFLLEAQRAGADVE
KKGANKTEFRYPSYVQHIMGDIFSQGFGPFRWVCTSGDPQDLAVTDELATSVLEEAIADG
VNPAVKLQYVDNIRWIREAARHRLVVGSQARILYSDQKGRVAIAVAFNQAIARGKIKAPV
VLSRDHHDVSGTDSPFRETSNIYDGSAFCADMAVQNFVGDAFRGATWVALHNGGGVGWGE
VINGGFGLVLDGTQEAEQKARMMLSWDVSNGVARRCWSGNRKAYEIICQTMQDNKGLVVT
LPQEVADERMLQQALRL
Download sequence
Identical sequences ENSFCAP00000014605

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]