SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000016343 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSFCAP00000016343
Domain Number - Region: 297-367
Classification Level Classification E-value
Superfamily TrmE connector domain 0.0549
Family TrmE connector domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000016343   Gene: ENSFCAG00000018847   Transcript: ENSFCAT00000018172
Sequence length 646
Comment pep:known_by_projection chromosome:Felis_catus_6.2:F1:67519013:67532352:-1 gene:ENSFCAG00000018847 transcript:ENSFCAT00000018172 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RLMVITPHRDGATGQRKLPHTTVQRLLNWGLPAPCGRFLQRQPGEFPVTAFLLGAGTGGL
LAMGLFQLLVNPMNIYEDQKVVTLYSLVGLGAVGWGTSPHIRCASLLLAPKMLGKEGRLF
VLGYALAAIYEGPAANLRHNLNEVVASLGCTVELQINNTRAAWRVSTAPLRAVFKGLLGS
KVSLKAETQNLSKAFEDLDAQVNSEMGYSPEDAESPEGTARGVGTHRAPPSGRRLSTQKM
YEPMLSCRRWFDQKHERCVERVRVPLLNHLLCLPMKFKFFCSIARAMEVWCRSRIPVEGN
FGQTYDSLNQSVRDLDGEFSATIDLKEEKQVAVLGLNTSWEHVSAELRDLVRRQEAQLGW
TLGLLRVLLSCTFLLVLHASFSYADSYNGDIRFDNIYISTYFCQIDERRKKLGKRTLLPL
RRAEEKTVIFPCSPFMQASEMRNVVRELAETLPVLLLLLVLCGLDRALYSVFNTIRHHSF
LQYSFRSSHKLEVKVGGDSMLARLLRKTIGALNTSSETTVDSSNLRCLPQPVSLNPRAYV
RAALPVGLLLCLCLLQAFGYRLRRVIAAFYFPKREKKRVLFLYNDLLRKRAAFTKLRRAA
IVSRAQRQRAPRHHLADVLHRRCPLLRRWLRRRCVVCQAPETPEAY
Download sequence
Identical sequences ENSFCAP00000016343

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]