SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000017137 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000017137
Domain Number 1 Region: 63-100
Classification Level Classification E-value
Superfamily Ribosomal protein L36 0.0000000000000589
Family Ribosomal protein L36 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000017137   Gene: ENSFCAG00000026326   Transcript: ENSFCAT00000026690
Sequence length 100
Comment pep:novel chromosome:Felis_catus_6.2:A1:238220749:238221051:1 gene:ENSFCAG00000026326 transcript:ENSFCAT00000026690 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MARVLVAKMLACALSPLLRGSPWPAKPRALSTLLAGPLRTAGPAGPWPLPGRLLPGLQLA
LGFKTKGVIKERCRDCYRVKRRGRWFIYCKTNPKHKQRQM
Download sequence
Identical sequences M3WS02
ENSFCAP00000017137 ENSFCAP00000000725 9685.ENSFCAP00000000725

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]