SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000017174 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000017174
Domain Number 1 Region: 27-158
Classification Level Classification E-value
Superfamily dUTPase-like 4.71e-38
Family dUTPase-like 0.000000587
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000017174   Gene: ENSFCAG00000029866   Transcript: ENSFCAT00000024124
Sequence length 160
Comment pep:novel chromosome:Felis_catus_6.2:X:55076489:55076971:1 gene:ENSFCAG00000029866 transcript:ENSFCAT00000024124 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPCSEATPTITPRKQPPPAEDTKRPGFVRLSEHATAPSKESTQGLGYDLYSAYDYTEPPV
EKALVKIDIQIALPSGCCGRVAPSSGLAAKHFIDVGAGVIDEDYRLNVGVVLFNFGKEKF
EVKKGDRIAQLICEWIFDPEIEEVQVLDDTERGSGGLGKN
Download sequence
Identical sequences ENSFCAP00000017174

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]