SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000017463 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000017463
Domain Number 1 Region: 230-375
Classification Level Classification E-value
Superfamily Retrovirus capsid protein, N-terminal core domain 1.1e-34
Family Retrovirus capsid protein, N-terminal core domain 0.0094
Further Details:      
 
Domain Number 2 Region: 711-800
Classification Level Classification E-value
Superfamily Acid proteases 1.34e-23
Family Retroviral protease (retropepsin) 0.00023
Further Details:      
 
Domain Number 3 Region: 583-714
Classification Level Classification E-value
Superfamily dUTPase-like 4.19e-23
Family dUTPase-like 0.00035
Further Details:      
 
Domain Number 4 Region: 1-93
Classification Level Classification E-value
Superfamily Retroviral matrix proteins 7.18e-21
Family Mason-Pfizer monkey virus matrix protein 0.00032
Further Details:      
 
Domain Number 5 Region: 381-453
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 1.15e-19
Family Retrovirus capsid protein C-terminal domain 0.0014
Further Details:      
 
Domain Number 6 Region: 519-548
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000000000607
Family Retrovirus zinc finger-like domains 0.00099
Further Details:      
 
Domain Number 7 Region: 485-516
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000112
Family Retrovirus zinc finger-like domains 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000017463   Gene: ENSFCAG00000027461   Transcript: ENSFCAT00000022412
Sequence length 800
Comment pep:novel chromosome:Felis_catus_6.2:F1:3335298:3337749:1 gene:ENSFCAG00000027461 transcript:ENSFCAT00000022412 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGQKQPTEQGYFVTALQALMKEEGIKVSQSALREFFDIVHAYCPWFPVGGTADLKDWQRV
GQELKNQMKIRGAAVPGTLWSTWTCIKEVLDPQDSIEIVSLSSEAAQPLVISDAPVPPET
TFNALSGQSRVPSPLPPLPLLEQLSVQDPENNDDSPFGDQGDDGPYLEDQRKPAFLAPLV
QKVPLKRPSFQAPDRGLPRLAFPVTQNQQSTEPYPVMGTTPLQRTLYQATQYGEDTSAFH
ADPVIQQGGQRVYSALSFKLLKDLKSSTAQYGPTAPFTLSVLDNLSREALCPGDWKVIAQ
ACLSAGDPLWKAEFAENAENQAMYNKRTNMPVDFHMLTGTGQYYDVGLQLNYPEVAYNQI
NTCAITAWKKLPSTGGRTEELSNIRQGPDEKYQDFVGRLLTAVSRIVTDGEAGTTIAKQS
TYKNANSACQAAIRPWKNQGTLEDDIRLCAETGPSYIQGITLAAALKGMDPLQVHAQLQG
KNVRTNPSKLGGIVCFKCGQKGHTKAQCRSGPNINNKPAIICPRCRRGYHWVNECRSKTD
SNGKPLQGNWKRGQPQAPQTIAAMFPQAPSHPLCPTLEISQLHHGTPASAGLDLTPDQSV
YLEGGQPPKAIPTGIWGPLPRNTWGLLLGRSSWTLKGLVIYPGVIDEDYTGEIKILASLP
MGTLVLEPKTPIAQLILTPRISSNNKAVKPYRGNQGFGSTDLYWAKVISVEKPMLTLHIQ
GVPFEGLVDTGADVSVIAQKKNWPVTWPTQVTNIPIKGVGYASAPLQSSDYLHWRLPDGM
TGTFQPFVLNIDLNLWGRDI
Download sequence
Identical sequences ENSFCAP00000017463

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]