SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000018121 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000018121
Domain Number 1 Region: 46-402
Classification Level Classification E-value
Superfamily Glutaminase/Asparaginase 3.93e-95
Family Glutaminase/Asparaginase 0.000000111
Further Details:      
 
Domain Number 2 Region: 444-591
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.46e-27
Family Ankyrin repeat 0.00099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000018121   Gene: ENSFCAG00000024828   Transcript: ENSFCAT00000031959
Sequence length 591
Comment pep:known_by_projection chromosome:Felis_catus_6.2:B3:146939216:146963556:1 gene:ENSFCAG00000024828 transcript:ENSFCAT00000031959 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RPPPSPGRDPPPDRTRHLPPAHLARRVSPPQAQPSPATLGMSRAVEPERRLLAIYTGGTI
GMRIERGVLVPGRGLAAALRTLPMFHDEDHARALGLPEDTLVLPPASPDQRVIYTVLECQ
PLFDSSDMTITEWVQIAQTIERHYGQYHGFVVVHGTDTMAFAASVLSFVLENLQKTVILT
GAQVPIHALWNDGRENLLGALLMAGQYVIPEVCLFFQNQLFRGNRVTKVDSRRFAAFCSP
NLPPLAVVGADVILNRELVRKVRGKERLVVHSSVERDVGLLRLYPGIPAALVRAFLQPPL
RGVVMETFGCGNGPTKPDLLREFRAATERGLLIVNCTHCLQGTVTSGYAAGMAVAGAGIV
SGFDMTSEAAMAKLSYVLGQPGLSLDSRKQLLARDLRGEVTLPAGDEHQPSLTCSTLGRG
VAQLLSLSQEADAVREALTPGLACAAAHAGDLDVLQALVELGSDLSQENFNGQTPLHAAA
RGGHPEVVTMLLQRGVGVSARDEDGLSPLLLAVKGRHQDIIGLLRAAGACLSPQELEDAG
TELCRLASRADLEGLQSWWRAGADLACPGYDGRSALLVAEAAGNLEVVTFL
Download sequence
Identical sequences ENSFCAP00000018121

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]