SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000020050 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000020050
Domain Number 1 Region: 141-272
Classification Level Classification E-value
Superfamily Acid proteases 2.36e-28
Family Retroviral protease (retropepsin) 0.00033
Further Details:      
 
Domain Number 2 Region: 12-129
Classification Level Classification E-value
Superfamily dUTPase-like 8.9e-23
Family dUTPase-like 0.00099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000020050   Gene: ENSFCAG00000027824   Transcript: ENSFCAT00000029842
Sequence length 288
Comment pep:novel chromosome:Felis_catus_6.2:X:73583287:73584150:-1 gene:ENSFCAG00000027824 transcript:ENSFCAT00000029842 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QWVSTPQHQQVTDLLYTTTGSAALDLPPIGPGVLQPSLGVVKVRTGIYGPLEKGTVGLIF
GRSSLTLKGIHVHPGVIHCDYENEIQVMKPADNPYTMQPRDKIAQLLILPYIEGQSNPVI
ITGGFGSTGKQLYWQTFLKDPHPEIYLKINNKSFIGLVDTGADVTIISEKFWPSSWPVEN
IPVIFTGLGSLGGIKRSQQFMRCEGPEDQIATLKPFVANIAINLWGRDLLQQWGAYINIS
SICTQSKNTMCTMGYDPLKGLDKNQRGIKTSLDIFPKHKATRLGYPNL
Download sequence
Identical sequences ENSFCAP00000020050

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]