SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000022726 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000022726
Domain Number 1 Region: 157-290
Classification Level Classification E-value
Superfamily Acid proteases 3.13e-26
Family Retroviral protease (retropepsin) 0.00082
Further Details:      
 
Domain Number 2 Region: 35-150
Classification Level Classification E-value
Superfamily dUTPase-like 8.37e-22
Family dUTPase-like 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000022726   Gene: ENSFCAG00000024251   Transcript: ENSFCAT00000028413
Sequence length 305
Comment pep:novel chromosome:Felis_catus_6.2:X:54826912:54828463:-1 gene:ENSFCAG00000024251 transcript:ENSFCAT00000028413 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SSNTTKSGKLLTGPSSGPNKQTIGLNTTTSMVTDLHHATTGSAALDLPAIDPVVSQHSLG
VVKVRTGIYGPLEKGTIGLIFGLRTLTLKDIHVHPDVIDCDYENEIQVMISADNTYTIQP
GDKIAQLFTLPYIEGQNNPVIRTGGFGSTGKQLYWKNPHPEIRLKINNKFFIGLGDTGAD
VTIVSERFLPSSWPVENVPVIFTGLESLGEIKRSQQIMRCEGPKDQIATLKPYVANIAIN
LWGRELLQKWGAYINIPSESTQNKNIMCTMGYDPLKGLDKNQQGIKTPLNIFPKHKATRL
GYPNL
Download sequence
Identical sequences ENSFCAP00000022726

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]