SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000023631 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000023631
Domain Number 1 Region: 18-149
Classification Level Classification E-value
Superfamily dUTPase-like 7.07e-21
Family dUTPase-like 0.00053
Further Details:      
 
Domain Number 2 Region: 147-275
Classification Level Classification E-value
Superfamily Acid proteases 9.85e-20
Family Retroviral protease (retropepsin) 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000023631   Gene: ENSFCAG00000021915   Transcript: ENSFCAT00000024795
Sequence length 290
Comment pep:novel chromosome:Felis_catus_6.2:X:64209502:64211224:-1 gene:ENSFCAG00000021915 transcript:ENSFCAT00000024795 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LWKAEFAENAEKQGISQLHRGTPASAGLDLTPAQSTYLEGGQPPKAIPTGIWGPLPRNTW
GLLLGRSSWTLKGLMIYPRVIDEDYTGEIKIFASLTMGTLVLEPKTPIAQLILIPRISSN
NKAVKPYWGNQVFSSTDLYWAKVISVKKPMLTLHIQGVPFEGLVDTGTDVSVIAQKNWPV
TWPTQVTNIPIKGVGMPLLRCKALIIYIRDCLMPFVLNIDLNLCDRDILTAMNLTLETKA
VPIQKQTNLAIHLMKKMGYTEGKGLGKELQENPEPYVPEPKRDHFGLGFS
Download sequence
Identical sequences ENSFCAP00000023631

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]