SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000024681 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000024681
Domain Number 1 Region: 117-228
Classification Level Classification E-value
Superfamily FMN-linked oxidoreductases 0.0000000000000151
Family FMN-linked oxidoreductases 0.00000461
Further Details:      
 
Domain Number 2 Region: 19-103
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.0000000000107
Family C-terminal domain of adrenodoxin reductase-like 0.071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000024681   Gene: ENSFCAG00000028398   Transcript: ENSFCAT00000022076
Sequence length 233
Comment pep:novel chromosome:Felis_catus_6.2:C1:81869101:81975437:-1 gene:ENSFCAG00000028398 transcript:ENSFCAT00000022076 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQFVRTEQDEMGNWNEHEDELVHLRADVVISAFGSVLSDPTVKEALSPLKFNRWNLPEVD
PETMQTSEPWVFAGGDIVGVANTTVESVNDGKQASWYIHKYIQSQYGASVSAKPEVPLFY
TPIDLVDISVEMAGLKFINPFGLASATPATSTSMIRRAFEAGWGFALTKTFSLDKDIVTN
VSPRIIRGTTSGPMYGPGQSSFLNIELISEKTAAYWCQSVTELKADFPDNVSV
Download sequence
Identical sequences ENSFCAP00000024681

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]