SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000024979 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000024979
Domain Number 1 Region: 63-100
Classification Level Classification E-value
Superfamily Ribosomal protein L36 0.000000000000772
Family Ribosomal protein L36 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000024979   Gene: ENSFCAG00000026543   Transcript: ENSFCAT00000032605
Sequence length 100
Comment pep:novel chromosome:Felis_catus_6.2:D2:51714907:51715209:1 gene:ENSFCAG00000026543 transcript:ENSFCAT00000032605 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MARVLVAKMLACALSPLLRGSPGPAKPRALSTLLAGPLRTAGPAGPWPLPGRLLPGLQLA
LGFKTKGVIKERCRDCYRVKRRGRWFIYCKTNSKHKQRQM
Download sequence
Identical sequences M3XEC2
ENSFCAP00000024979

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]