SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000004282 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000004282
Domain Number 1 Region: 548-673
Classification Level Classification E-value
Superfamily PH domain-like 2.9e-19
Family Pleckstrin-homology domain (PH domain) 0.026
Further Details:      
 
Domain Number 2 Region: 84-262
Classification Level Classification E-value
Superfamily ARM repeat 0.0000000158
Family HspBP1 domain 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000004282   Gene: ENSFCAG00000004630   Transcript: ENSFCAT00000004634
Sequence length 727
Comment pep:known_by_projection chromosome:Felis_catus_6.2:A2:127323588:127755241:-1 gene:ENSFCAG00000004630 transcript:ENSFCAT00000004634 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPPPADIVKVAIEWPGAYPKLMEIDQKKPLSAIIKEVCDGWSLANHEYFALQHADSSNFY
ITEKNRNEIKNGTILRLTTSPAQNAQQLHERIQSSSMDAKLEALKDLASLSRDVTFAQEF
INLDGISLLTQMVESGTERYQKLQKIMKPCFGDMLSFTLTAFVELMDHGIVSWDTFSVAF
IKKIASFVNKSGMDISILQRSLAILESMVLNSHDLYQKVAQEITIGQLIPHLQGTDQEIQ
TYTIAVINALFLKAPDERRQEMANILAQKQLRSIILTNVIRAQRAINNEMAHQLYVLQVL
TFNLLEDRMMTKMDPQDQAQRDIIFELRRIAFDAESEPNNSSGSMEKRKSMYTRDYKKLG
FINHVNPAMDFTQTPPGMLALDNMLYFAKHHQDAYIRIVLENSSREDKHECPFGRSSIEL
TKMLCEILKVGELPSETCNDFHPMFFTHDRSFEEFFCICIQLLNKTWKEMRATSEDFNKV
MQVVKEQVMRALTTKPSSLDQFKCKLQNLSYTEILKIRQSERMNQEDFQSRPILELKEKI
QPEILELIKQQRLNRLVEGTCFRKLNCRRRQDKFWYCRLSPNHKVLHYGDLEESPQGEVP
HDSLQDKLPVADIKAVVTGKDCPHMKEKGALKQNKEVLELAFSILYDSNCQLNFIAPDKH
EYCIWTDGLNALLGKDMMSELTRNDLDTLLSMEIKLRLLDLENIQIPDAPPPIPKEPSNY
DFVYDCN
Download sequence
Identical sequences A0A2I2U1D7
XP_014920506.1.86478 XP_019273657.1.44245 XP_019681267.1.62641 ENSFCAP00000004282

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]