SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000006108 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000006108
Domain Number 1 Region: 2-566
Classification Level Classification E-value
Superfamily Acetyl-CoA synthetase-like 6.15e-84
Family Acetyl-CoA synthetase-like 0.0000321
Further Details:      
 
Domain Number 2 Region: 751-1094
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 2.2e-46
Family Quinoprotein alcohol dehydrogenase-like 0.0083
Further Details:      
 
Domain Number 3 Region: 551-609
Classification Level Classification E-value
Superfamily ACP-like 0.0000183
Family Acyl-carrier protein (ACP) 0.081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000006108   Gene: ENSFCAG00000006574   Transcript: ENSFCAT00000006576
Sequence length 1096
Comment pep:known_by_projection chromosome:Felis_catus_6.2:B1:160153086:160197427:1 gene:ENSFCAG00000006574 transcript:ENSFCAT00000006576 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTLQELVHRAASIYSDKIAVCFDECNNQPPVYYTYKSVVHAASELSNFLLLHCDFQGIRE
VGLYCHPGINLPSWILGILQVPAAYAPIDPDAPPALSTHFMKKCNLSYILVEKQQINKFK
SSYETLLNYDTLTEHTDLVLFRLHWENVAVSLMLNDRKQKYEEGKMTNSTNSENNEEKSE
EHMDVRLNHCLAYVLHTSGTTGIPKIVRVPHACILPNIQHFRLLFEITQEDVLFMASPLT
FDPSVVEIFVALSSGACLLIVPASVKVLPSKLAAVLFSRHRVTILQATPTLLRRFGSQLI
KSTVLSASTSLRVLALGGEAFPSLAVLKSWRGVGNKTQIFNIYGITEVSSWATFYKIPEK
FLNSTLKCELPVPLGFPLLGTVVEVRDTNGFTIQEGNGQVFLGGKNRVCFLDDEMIVPLG
TMRATGDLVTVKDGEMFFLGRKDSQIKRYGKRLNIEFVQQVAEGLQQVESCAVTWYNQEK
LILFMVSKNDVVKEYIFKELQEHLPSHAIPDELVLIDSLPFTSHGKIDVSELNKIYLNYI
NLKSECKLNGKEELWEKLQHLWKSILSLSEHPLKVPDESLFLNSGGDSLKSIRLLNEIEK
LVGTSIPGLLEIILSSSILEIYNHVLQTVFPDEDLLFSKNYAMKRKFSDINQEEISGKSL
PQKSVQTLSCDNELAAFIAVSRGSQILSLNSEFLTKLGLGSSAGSSDLISQTNIQNVTSL
SPPALTGKSKDPSCVAEVSHEGTSVIEAKKMELHVRWRTDTGKCVDASPLVVISAAAKSS
VTVYIGSHSHRMMAVDLYSGKVKWEQILGGRIESSACVSKCGNFIVVGCYNGLVYVLKSN
SGEEYWMFTTKDAVKSSATMDPTTGLLYIGSHDQHAYALDIYKKKCVWKLKCGGTVFSSP
CLSLIPHHLYVATLGGLLLAIHPATGNTVWKHSCGKPLFSSPRCCLQYICIGCVDGNLLC
FTHFGEQVWQFSTSEPIFSSPCTSASEQEIFFGSHDCFIYCCNMKGHLQWKFETTSQVYA
TPFAFCYQDCSNEMLLAAASTDGKLWILESKSGRLQSVYELPGQVFSSPVVWESMLLIGC
RNNYVYCLDLLGGHQI
Download sequence
Identical sequences XP_006931169.1.62641 XP_019685034.1.62641 XP_019685035.1.62641 ENSFCAP00000006108

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]