SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000006156 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000006156
Domain Number 1 Region: 312-507
Classification Level Classification E-value
Superfamily Hemopexin-like domain 1.44e-69
Family Hemopexin-like domain 0.000012
Further Details:      
 
Domain Number 2 Region: 114-283
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 4.59e-55
Family Matrix metalloproteases, catalytic domain 0.000000025
Further Details:      
 
Domain Number 3 Region: 28-97
Classification Level Classification E-value
Superfamily PGBD-like 5.97e-20
Family MMP N-terminal domain 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000006156   Gene: ENSFCAG00000006626   Transcript: ENSFCAT00000006628
Sequence length 582
Comment pep:known_by_projection chromosome:Felis_catus_6.2:B3:75171657:75180703:1 gene:ENSFCAG00000006626 transcript:ENSFCAT00000006628 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSPAPRPAGGLLLPLLTLATALASLSSAQSSFSPEAWLQQYGYLPPGDLRTHTQRSPQSL
SAAIAAMQRFYGLRVTGKADADTMKAMRRPRCGVPDKFGAEIKANVRRKRYAIQGLKWQH
NEITFCIQNYTPKVGEHATFEAIRKAFRVWESATPLRFREVPYAYIREGHEKQADIMIFF
AEGFHGDSTPFDGEGGFLAHAYFPGPNIGGDTHFDSAEPWTVRNEDLNGNDIFLVAVHEL
GHALGLEHSNDPSAIMAPFYQWMDTENFVLPDDDRRGIQQLYGSESGFPTKMPPQPRTTS
RPSVPDKPKNPTYGPNICDGNFDTVAVLRGEMFVFKERWFWRVRNNQVMDGYPMPIGQFW
RGLPASINTAYERKDGKFVFFKGDKHWVFDEASLEPGYPKHIKELGRGLPTDKIDAALFW
MPNGKTYFFRGNKYYRFNEELRAVDSEYPKNIKVWEGIPESPRGSFMGSDEVFTYFYKGN
KYWKFNNQKLKVEPGYPKSALRDWMGCPSSGGRPDEGTEEETEVIIIEVDEEGGGAVSAA
AVVLPVLLLLLVLAVGLAVFFFRRHGTPKRLLYCQRSLLDKV
Download sequence
Identical sequences M3W681
XP_003987503.1.62641 ENSFCAP00000006156

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]