SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000008594 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000008594
Domain Number 1 Region: 546-674
Classification Level Classification E-value
Superfamily PH domain-like 3.69e-17
Family Pleckstrin-homology domain (PH domain) 0.03
Further Details:      
 
Domain Number 2 Region: 86-251
Classification Level Classification E-value
Superfamily ARM repeat 0.000096
Family HspBP1 domain 0.064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000008594   Gene: ENSFCAG00000009269   Transcript: ENSFCAT00000009271
Sequence length 728
Comment pep:known_by_projection chromosome:Felis_catus_6.2:E2:44981243:44985491:1 gene:ENSFCAG00000009269 transcript:ENSFCAT00000009271 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPPRNVVKIAVQMRDAIPQLIRLDQAKPLAAVLKEVCDAWSLVHSERYALQFADGHRKY
ITENNRTEIKNGSILCLSTAPDLEAERLLGGLQCGSRERRRETLQHLVLLAPDMTFAQEV
ISRDGLQRLGTIIEDGDDGLVLLSPICPPSLGELLALALRAFLELMEHGMVSWETLSIPF
VRKVVCYVNMNLMDASVQPLALRLLESVTLSSPALGQLVKSEVPLDRLLVHLQVMNQQLQ
TKAMALLTALLQGASSTERKHMFDYLWQRNLRQFIYKNIIHSAAPLGDEMAHHLYVLQAL
MLGLLEPRMRTPLDPYSQEQREQLQALRQAAFDPEGESLGTGLSADRRRSLCAREFRKLG
FSNSNPAQDLERVPPGLLALDNMLYFSRHAPSAYSRFVLENSSREDKHECPFARSSIQLT
VLLCELLRIGEPCSETAQDFSPMFFSQDQSFHELFCVSIQLLNKTWKEMRATQEDFDKVM
QVVREQLARTLALKPSSLELFRTKVNALPYGEVLRLRQTERLHQEGTLAPPILELREKLK
PELMGLIRQQRLLRLCEGTLFRKISSRRRQDKLWFCCLSPNHKVLQYGDVEEGSSPPTPE
SLPEQLPVADIKALLTGKDCPHVREKGSGKQNKDLYELAFSVSYDHGEEEAYLNFIAPSK
REFHLWTDGLSALLGSPMGSEQTRLDLEQLLTMETKLRLLELENVPIPEQPPPIPPPPTN
FNFCYDCS
Download sequence
Identical sequences ENSFCAP00000008594

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]