SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000010872 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000010872
Domain Number 1 Region: 254-345
Classification Level Classification E-value
Superfamily TAFH domain-like 4.84e-33
Family TAFH domain-like 0.0000303
Further Details:      
 
Domain Number 2 Region: 654-702
Classification Level Classification E-value
Superfamily Histone-fold 0.00000000000000126
Family TBP-associated factors, TAFs 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000010872   Gene: ENSFCAG00000011715   Transcript: ENSFCAT00000011717
Sequence length 864
Comment pep:known_by_projection chromosome:Felis_catus_6.2:D3:49966424:50091609:1 gene:ENSFCAG00000011715 transcript:ENSFCAT00000011717 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPAGLTEPAGAAPPAGVSASGTVTMAPAGTLPVRVESTPVALGAVTKAPVSVCVESTVSQ
PLRSPVGTLVTKVASVSALPKLSSGPPLPAPQIVAVKAPNTTTIQLPANLQLPPGTVLIK
SNSGQLMLVSPQQAVTRAETTTNITSRPAIPTNTHTVKICTVPNSGSQLVKKVAVAPVKK
LAQIGTTVVTTVPKPSSVQSVAVPTASVVTVTPGKPLNSVTTLKPSNLGASPALSNDPSL
KAENSAAAQANLSPAMLENVKKCKNFLAMLIKLACSGSQSPEMGQNVKKLVEQLLDAKIE
AEEFTRQLYVELKSSPQPHLVPFLKKSVIALRQLMPNSQSFIQQCVQQTCSEVVIATCTT
TAATSPVVTTTVCSIQPEKPIIVSGTTTASTVSVPALNPLAGPGGAKPGVVTLHSLGPPA
APGGTAAGTVLLQTSKPLVTSIQNTVTAVSLPPEKPAVSGAAVTLALPAVTFGEPSAAAV
CLPSVKPVMTSAGTTSDKPVIAPVQIKLAPPGPVLSQPAGIPQAVKVKQLVVQQPSGGVA
KQVTTLPHSSALTIQKSGQKKMPVSTAIPASQFPPASILKQITLPGNKILSLQASSIQKN
KVKENGITSFRDEDDINDVASMAGVNLSEENACILATNSDLVGTLVQSCKDEPFLFIGAL
QKRILDIGKKHDITELNSDAVNLISHATQERLRGLLEKLTTIAQHRMTTYKASENYILSS
DTRSQLKFLEKLDQLEKQRKDLEEREMLLRVAKSRSNKEDPEQLRLKQKAKELQQLELAQ
IQHRDANLTALAAIGPRKKRPLESGSGSEGLKDNLLASGTSSLTATKQLLRPRITRICLR
DLIFCMEQEREMKYSRALYLALLK
Download sequence
Identical sequences M3WFL7
XP_006938888.1.62641 ENSFCAP00000010872

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]