SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000011127 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000011127
Domain Number 1 Region: 143-236
Classification Level Classification E-value
Superfamily TAFH domain-like 6.93e-36
Family TAFH domain-like 0.00000316
Further Details:      
 
Domain Number 2 Region: 543-590
Classification Level Classification E-value
Superfamily Histone-fold 2.72e-17
Family TBP-associated factors, TAFs 0.00019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000011127   Gene: ENSFCAG00000011994   Transcript: ENSFCAT00000011997
Sequence length 756
Comment pep:known_by_projection chromosome:Felis_catus_6.2:A3:1847446:1875545:1 gene:ENSFCAG00000011994 transcript:ENSFCAT00000011997 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LSPGMVLVRSENGQLLMIPQQALAQMQAQAHVQTQPQTTMAPRPATPTSAPPVQISTVQV
TPTTIIKQVSQAQTTVQPATALQRSPGVQTTSLGTATTVQTGTPQRTVPGATTTSTAATG
RAARGEHGPGTSASPRRAVSQRALQETMENVKKCKNFLSTLIKLASSGKQSTETAANVKE
LVQNLLDGKIEAEDFTSRLYRELNSSPQPYLVPFLKRSLPALRQLTPDSAAFIQQSQQQP
PPASQATTALTAVVLSSSVQRTAGKTAATVTSALQPPVISLTQPTQVGVGKRGQPTPLSR
RGWGVCGGGAAVGSGLSPVHSWILEAYGVSPASVSHQVTDPVREGKRALRSLAAVSPSET
AGSACLVLAPTSGPTCRSAPRAHLFCGADVGVQVPAGPRPGVGAHGPVALPQVIQQPPKP
GALIRPPQVTLTQTPMVALRQPHSRIVLTAPQQIQLNQLQPVPVVKPAVLPGTKALSAVS
AQAAAAQKNKLKEPGGGSFRDDDDINDVASMAGVNLSEESARILATNSDLVGTLTRSCKD
ETFLLPAPLQRRILEIGKKHGITELHPDVVSYVSHATQQRLQNLVEKISETAQQKNFSYK
DDDRYEQASDVRAQLKFFEQLDQIEKQRKDEQEREILMRAAKSRSRQEDPEQLRLKQKAK
EMQQQELAQMRQRDANLTALAAIGPRKKRKVDSPGPGSGTEGSGPGSAVPGSSGVGTPRQ
FTRQRITRVNLRDLIFCLENERETSHSLLLYKAFLK
Download sequence
Identical sequences ENSFCAP00000011127

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]