SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000011202 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000011202
Domain Number 1 Region: 626-796
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 1.43e-52
Family BCR-homology GTPase activation domain (BH-domain) 0.0000714
Further Details:      
 
Domain Number 2 Region: 55-266
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.7e-43
Family DBL homology domain (DH-domain) 0.0004
Further Details:      
 
Domain Number 3 Region: 282-351,409-443
Classification Level Classification E-value
Superfamily PH domain-like 5.73e-20
Family Pleckstrin-homology domain (PH domain) 0.025
Further Details:      
 
Domain Number 4 Region: 486-592
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.000000000000133
Family Synaptotagmin-like (S variant) 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000011202   Gene: ENSFCAG00000012073   Transcript: ENSFCAT00000012077
Sequence length 842
Comment pep:known_by_projection chromosome:Felis_catus_6.2:E1:15667337:15759010:-1 gene:ENSFCAG00000012073 transcript:ENSFCAT00000012077 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LVSDFSYGADDYDGEGNEEQKGPPEGSETMPYIDESPTMSPQLSARGQGGGDSISPTPPE
GLAPGVEAGKGLEMRKLVLSGFLASEEIYINQLEALLLPMKPLKATATTSQPVLTIQQIE
TIFYKIQDIYEIHKEFYDNLCPKVQQWDSQVTMGHLFQKLASQLGVYKAFVDNYKVALET
AEKCSQSNNQFQKISEELKVKGPKDSKDSHTSVTMEALLYKPIDRVTRSTLVLHDLLKHT
PVDHPDYPLLQDALRISQNFLSSINEDIDPRRTAVTTPKGETRQLVKDGFLVEVSESSRK
LRHVFLFTDVLLCAKLKKTSAGKHQQYDCKWYIPLADLVFPSPEESEASPQVHPFPDHEL
EDMKMKISALKSEIQKEKANKGQSRAIERLKKKMFENEFLLLLNSPTIPFRIHNRNGKSY
LFLLSSDYERSEWREAIQKLQKKDLQAFVLSSVELQVLTGSCFKLRTVHNIPVTSNKDDD
ESPGLYGFLHVIVHSAKGFKQSANLYCTLEVDSFGYFVSKAKTRVFRDTTEPKWDEEFEI
ELEGSQSLRILCYEKCYDKTKVNKDNNEIVDKIMGKGQIQLDPQTVETKNWHTDVIEMNG
IKVEFSMKFTSRDMSLKRTPSKKQTGVFGVKISVVTKRERSKVPYIVRQCVEEVEKRGIE
EVGIYRISGVATDIQALKTVFDANNKDILLMLSDMDINAIAGTLKLYFRELPEPLLTDRL
YPAFMEGIALSDPAAKENCMMHLLRTLPDPNLITFLFLLEHLKRVAEKEPINKMSLHNLA
TVFGPTLLRPSEVESKAHLTSAADIWSHDVMAQVQVLLYYLQHPPISFAELKRNTLYFST
DV
Download sequence
Identical sequences ENSFCAP00000011202

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]