SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000012951 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000012951
Domain Number 1 Region: 282-472
Classification Level Classification E-value
Superfamily Hemopexin-like domain 4.71e-58
Family Hemopexin-like domain 0.000092
Further Details:      
 
Domain Number 2 Region: 82-256
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 3.91e-44
Family Matrix metalloproteases, catalytic domain 0.0000319
Further Details:      
 
Domain Number 3 Region: 22-90
Classification Level Classification E-value
Superfamily PGBD-like 0.00000000000000502
Family MMP N-terminal domain 0.008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000012951   Gene: ENSFCAG00000013966   Transcript: ENSFCAT00000013970
Sequence length 529
Comment pep:known_by_projection chromosome:Felis_catus_6.2:B4:84846287:84851229:-1 gene:ENSFCAG00000013966 transcript:ENSFCAT00000013970 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNWQWLWLGFLLLMTVSGQTLGPSGKEAAVDYLLQYGYLQKPLEGPDDFKPEDIMEALRA
FQEASELPVSGQLDDATRARMRQPRCGLEDPFNQKTLKYLLLGRWRKKHLTFRILNLPST
LPPHTARAALLQAFQYWSNVAPLTFREVQAGWADIRLSFHGRQSPYCSNSFDGPGRVLAH
ADIPELGSVHFDEDELWTERTYRGVNLRIIAAHELGHALGLGHSRYTQALMAPVYAGYRP
HFKLHPDDVAGIQALYGKKSPETEDEEEEMELPTVPHVPTEPSPMPDPCSGELDAVMLGP
RGKTYAFKGNYVWTVTDSGLGPLFQVSALWEGLPGNLDAAVYSPRTQWIHFFKGDKVWRY
INFKMSPGFPKKLNRVDPHLDAALYWPFNKKVFLFKGSGYWQWDELARTDFSHYPKPIKG
LFTGVPDQPSAAMGWRDGHVYFFKGKQYWRLNQQLRVEKGYPRDTAHNWMHCHPQTSDNT
PLGGNTTPSAIDTTLNTAPSPRDPILDITPSATVSSTLSFPGNVSLADD
Download sequence
Identical sequences ENSFCAP00000012951

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]