SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000013163 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000013163
Domain Number 1 Region: 725-899
Classification Level Classification E-value
Superfamily Tropomyosin 0.0000275
Family Tropomyosin 0.004
Further Details:      
 
Domain Number 2 Region: 627-720
Classification Level Classification E-value
Superfamily Tropomyosin 0.0000621
Family Tropomyosin 0.012
Further Details:      
 
Weak hits

Sequence:  ENSFCAP00000013163
Domain Number - Region: 438-477
Classification Level Classification E-value
Superfamily EB1 dimerisation domain-like 0.00327
Family EB1 dimerisation domain-like 0.0084
Further Details:      
 
Domain Number - Region: 197-376
Classification Level Classification E-value
Superfamily Tropomyosin 0.00621
Family Tropomyosin 0.01
Further Details:      
 
Domain Number - Region: 879-1101
Classification Level Classification E-value
Superfamily Tropomyosin 0.0167
Family Tropomyosin 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000013163   Gene: ENSFCAG00000014189   Transcript: ENSFCAT00000014193
Sequence length 1140
Comment pep:known_by_projection chromosome:Felis_catus_6.2:B1:160512421:160576526:-1 gene:ENSFCAG00000014189 transcript:ENSFCAT00000014193 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTTAAERKYINIRKRLDQLGYRQTLTVECLPLVEKLFSDLVHTTESLRKSKLSAVKAEKE
SANFDFVLEPYKLENARLIKENNELYLELMKLREQSSQHIKELKTTLKKCARETADLKFL
NNQYVHKLKLLEKESKAKNERIQQLQEKNLHAVVQTPGGKKRSIAFRRQRMQIDEPVPPS
EVSSYPVPQPDDPYIADLLQVADNRIQELQEEVHQLQEKLAMMESELRDYNQQIELRERE
IERLSVALDSGRSPDVLSLETRNKTNEKLIAHLNVQVDFLQQANKDLEKHIQELMETKET
VTTEVVNLSNKNEKLCQELTEIDQLAQQLERHKEEVLETADKELGEAKKEIKRKLSEMRD
LEETMAKLQLELNLCHKEKERLSDELLIKSDLETVVHQLEQEKQRLNKKMESFAVTEREL
TLEVERMRLEHGIKRRDKSPSRLDTFLKGIEEERDFYKKELERLQHIIQRRSCSTNHSTR
EKIPIFKTLEKGDYNSEVHLITRERDELQRMLERFERHMEDIQSNVKLLTAERDKLSVLY
NEAQEQLRALRQESTQTTASHNIISLMEKEKELALSDLRRIMAEKEALKEKLKNLQEMSI
FEKSKLEKTIEHLTRVNHQHEDEKCELKSKMLIMKETVESLENKAKLQAQKLSHVAGDSS
HHKTEMNSLRLVNEQLQQSLDDCQHRLSKKRGELESAQSQINLLEEKIGKLHLQMTSQSE
EAHVMKKTIGAIDKEKDFLQETVDEKTEKIANLQENLANKGKAIAQMKITVSEYDSSMNQ
LKETLTSRDREISSLRRQLDTAHKELDEVGRSKEVSFKENRRLQDDLATMARENQEISLE
LEAAVQEKEEMKSRVHNYITEVSRWESLMAAKEKENQDLLDRFQMLHNRAEDWEVKAHQA
EGESSSVRLELLSIDTERRHLRERVELLEKEIQEHINAHHAYESQISSMAKAMSRLEEEL
RHQEDAKAVALNDLSSLRELCIKLDSGKDLMTQQLNSKNLEFERVVVELENVKSEADLFK
KQLASERHTIKSLESLLATNRDKEFHSHLTSHEKDTEIQLLKEKLTLSESKLTSLGRENT
MLRAKVTQLQTDHDSMKRQISTERYERERAIQEMRRHGLPTPPLSSTLRSPLHSPEHISC
Download sequence
Identical sequences ENSFCAP00000013163

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]