SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000014643 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000014643
Domain Number 1 Region: 273-465
Classification Level Classification E-value
Superfamily Hemopexin-like domain 1.96e-64
Family Hemopexin-like domain 0.00000101
Further Details:      
 
Domain Number 2 Region: 101-261
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 7.1e-55
Family Matrix metalloproteases, catalytic domain 0.00000698
Further Details:      
 
Domain Number 3 Region: 32-96
Classification Level Classification E-value
Superfamily PGBD-like 1.13e-18
Family MMP N-terminal domain 0.00095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000014643   Gene: ENSFCAG00000015789   Transcript: ENSFCAT00000015793
Sequence length 513
Comment pep:known_by_projection chromosome:Felis_catus_6.2:D1:1305582:1316969:-1 gene:ENSFCAG00000015789 transcript:ENSFCAT00000015793 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKSLLLLFLLCVTFCSTFPTARKMDPEETMHLAQAYLNQFYSLEIEGSHLVQSKNRTLID
GKIREMQAFFGLAVTGQLDSNTLAIMTTPRCGVPDVGQYGYTLPGWRRHNLTYRIVNYTP
DMSRADVDEAIRNGLEVWSRVTPLTFTKTSRGIADIMIAFRTRVHGRCPRYFDGPLGVLG
HAFPPGLGLGGDTHFDEDENWTKDGAGFNLFLVAAHEFGHALGLSHSNDQTALMFPNYVS
LDPNKYPLSQDDINGIQSIYGSLPKASAKPKGPTVPHACDPDLTFDAVTTLRREVMFFKG
RHVWRIYYDITDVEFELISSFWPLLPTDIQAAYENPKDKILVFKDDNFWMIRGYAVLPDY
PKSIHTLGFPRHVKKIDAAVCDHSLRKTYFFVGIWCWRFDEATQTMDKGYPRRVVKYFPG
IGLRVDAAFQYKGFFYFFRGSKQFEYDPKAKNITRMMKTNTWFQCKEPLNSSSDFSVSEE
EVHSGGVEMFYRTNVNLLIFSIVHVLKEVMMYK
Download sequence
Identical sequences ENSFCAP00000014643

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]