SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000017782 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000017782
Domain Number 1 Region: 336-532
Classification Level Classification E-value
Superfamily Hemopexin-like domain 1.96e-70
Family Hemopexin-like domain 0.00000712
Further Details:      
 
Domain Number 2 Region: 119-294
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 2.22e-55
Family Matrix metalloproteases, catalytic domain 0.0000000543
Further Details:      
 
Domain Number 3 Region: 29-106
Classification Level Classification E-value
Superfamily PGBD-like 8.32e-21
Family MMP N-terminal domain 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000017782   Gene: ENSFCAG00000027771   Transcript: ENSFCAT00000023029
Sequence length 607
Comment pep:known_by_projection chromosome:Felis_catus_6.2:F2:35072352:35360397:-1 gene:ENSFCAG00000027771 transcript:ENSFCAT00000023029 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MILLTFSTGRRLDFVHHSGVFFLQTLLWILCATVCGTEQYFNVEVWLQKYGYLPPTDPRM
SVLRSAETMQAALAAMQQFYGINMTGKVDRNTIDWMKKPRCGVPDQTRGSSKFNIRRKRY
ALTGQKWQHKHITYSIKNVTPKVGDPETRKAIRRAFDVWQNVTPLTFEEVPYSELENGKR
DVDITIIFASGFHGDSSPFDGEGGFLAHAYFPGPGIGGDTHFDSDEPWTLGNPNHDGNDL
FLVAVHELGHALGLEHSNDPTAIMAPFYQYMETDNFKLPNDDLQGIQKIYGPPDKIPPPT
RPLPTVPPHRSIPPADPRKNDRPKPPRPPTGRPSYPGAKPNICDGNFNTLAILRREMFVF
KDQWFWRVRNNRVMDGYPMQITYFWRGLPPSIDAVYENSDGNFVFFKGNKYWVFKDTTLQ
PGYPHDLITLGSGTPPHGIDSAIWWEDVGKTYFFKGDRYWRYSEEMKTMDPGYPKPITVW
KGIPESPQGAFVHKENGFTYFYKGKEYWKFNNQILKVEPGYPRSILKDFMGCDGPTDRDK
EGHSPPDDVDIVIKLDNTASTVKAIAIVIPCILALCLLVLVYTVFQFKRKGTPRHILYCK
RSMQEWV
Download sequence
Identical sequences M3WTU5
XP_004000005.1.62641 XP_007084386.1.5354 XP_014930226.1.86478 XP_019308956.1.44245 ENSFCAP00000017782

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]