SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000018242 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000018242
Domain Number 1 Region: 2-87
Classification Level Classification E-value
Superfamily ARID-like 1.01e-26
Family ARID domain 0.00083
Further Details:      
 
Domain Number 2 Region: 497-574
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 8.16e-17
Family P4 origin-binding domain-like 0.0083
Further Details:      
 
Domain Number 3 Region: 135-179,235-423
Classification Level Classification E-value
Superfamily ARM repeat 0.00000576
Family Clathrin adaptor core protein 0.026
Further Details:      
 
Weak hits

Sequence:  ENSFCAP00000018242
Domain Number - Region: 1605-1630
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0844
Family Classic zinc finger, C2H2 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000018242   Gene: ENSFCAG00000012831   Transcript: ENSFCAT00000031830
Sequence length 1808
Comment pep:known_by_projection chromosome:Felis_catus_6.2:B4:75565558:75735072:1 gene:ENSFCAG00000012831 transcript:ENSFCAT00000031830 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SRRSPFKKIPAVGGKELDLHGLYTRVTTLGGFAKVSEKNQWGEIVEEFNFPRSCSNAAFA
LKQYYLRYLEKYEKVHHFGEDDDEVPPGNPKPQLPIGAIPSSYNYQQHSVSDYLRQSYGL
SMDFNSPNDYNKLVLSLLSGLPNEVDFAINVCTLLSNESKHVMQLEKDPKIITLLLANAG
VFDDTLGSFSTVFGEEWKEKTDRDFVKFWKDIVDDNEVRDLISDRNKSHEGTSGEWIWES
LFHPPRKLGINDIEGQRVLQIAVILRNLSFEEGNVKLLAANRTCLRFLLLSAHSHFISLR
QLGLDTLGNIAAELLLDPVDFKTTHLMFHTVTKCLMSRDRFLKMRGMEILGNLCKAEDNG
VLICEYVDQDSYREIICHLTLPDVLLVISTLEVLYMLTEMGDVACTKIAKVEKSIDMLVC
LVSMDIQMFGPDALAAVKLVEHPSSSHQVLSEIRPQAVEQVQTQTHVASTPASRAVVAQH
VAPPPGIVEIDSEKFACQWLNAHFEVNPDCSVSRAEMYSEYLSTCSKLARGGILTSTGFY
KCLRTVFPNHTVKRVEDSSSNGQAHIHVVGVKRRAIPLPIQMYYQQQPVSTPVVRVDSVP
DVSPSPSPAGIPHGPQTVGNHFQRTSVTNQSSNLTATQMSFPVQGVHTVAQTVSRIPPNP
TVHTHQQQNAPVTVIQNKAPIPCEVVKATVIQNSLPQTAVPVSIAVGGGAAQSSVVQNHS
TGPQPVTVVNSQTLLHHPSVIPQQSPLHTVVPGQIPSGTPVTVIQQAVPQSHIFGRVQNI
PACTSTVSQGQQLITTSPQPVQTSSQQTSAGSQPQDTVIIAPSQYVTTSASNIVSATSVQ
NFQVATGQMVTIAGVPSPQPSRVGFQNIAPKPLPSQQVSSTVVQQPIQQPQQPTQQSVVI
VSQPAQQGQTYAPAIHQIVLANPAALPAGQTVQLTGQPNITPSSSPSPVPATNNQVPTAM
SSSSAPQSQGPPPTVSQMLSVKRQQQQQHSPAPSPQQVQVQVQQPQQVQMQVQPQQTNAG
VGQPASGESSLIKQLLLPKRGPSTPGGKLILPAPQIPPPNNARAPSPQVVYQVANNQAAG
FGVQGQTSAQQLLVGQQNVQLVQSAMPPAGGVQTVPISNLQILPGPLISNSPATIFQGTS
GNQVTITVVPNTSFATATVSQGNATQLIAPAGITMSGTQAGVGLQVQTLPATQTSPAGQS
SCTTATPPFKGDKIICQKEEEAKEATGLHVHERKIEVMENPSCRRGTTNTSNGDTKENEM
QVGSLLNGRKYSDSSLPPSNSGKIQSEANQCSLISNGPSLELGENGTSGKQNSEQIDMQD
IKSDLKKPLVNGICDFDKGDGSHLSKNIPNHKTSNHVGNGEISPMEPQGTLDATQQDTAK
GDQLERISNGPILTLGGSPSVSSIQEAPNVATQQFSGTDLPNGPLASSLNSDVPQQRPSV
VVSPHSTTSVIQGHQVVAVPHSGSRVSHSPALSSDVRSTNGTAECKTVKRPAEDNDRETV
TGIPNKVGVRIVTISDPNNAGCSATMVAVPAGADPSTVAKVAIESAVQQKQQHPPTYVQN
VVPQNTPMTPSPAAQVQNQPSTSQPSPFSASSQQGDPVRKPGHNFMCLWQSCKKWFQTPS
QVFYHAATEHGGKDVYPGQCLWEGCEPFQRQRFSFITHLQDKHCSKDALLAGLKQDEPGQ
AGSQKSSTKQPAVGGTSSTPRAQKAIVNHPSAALMALRRGSRNLVFRDFTDEKEGPITKH
IRLTAALILKNIGKYSECGRRLLKRHENNLSVLAISNMEASSTLAKCLYELNFTVQSKEQ
EKDSEMLQ
Download sequence
Identical sequences ENSFCAP00000018242

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]