SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000019067 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000019067
Domain Number 1 Region: 432-820
Classification Level Classification E-value
Superfamily Ankyrin repeat 6.84e-131
Family Ankyrin repeat 0.000000000348
Further Details:      
 
Domain Number 2 Region: 188-450
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.61e-73
Family Ankyrin repeat 0.000003
Further Details:      
 
Domain Number 3 Region: 32-222
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.82e-47
Family Ankyrin repeat 0.00012
Further Details:      
 
Domain Number 4 Region: 3565-3630
Classification Level Classification E-value
Superfamily DEATH domain 1.27e-17
Family DEATH domain, DD 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000019067   Gene: ENSFCAG00000005384   Transcript: ENSFCAT00000023683
Sequence length 3961
Comment pep:known_by_projection chromosome:Felis_catus_6.2:B1:110423676:110761176:-1 gene:ENSFCAG00000005384 transcript:ENSFCAT00000023683 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMNEDAAQKSDSGEKFNGSSQRRKRPKKSDSNASFLRAARAGNLDKVVEYLKGGIDINTC
NQNGLNALHLAAKEGHVGLVQELLGRGSSVDSATKKGNTALHIASLAGQAEVVKVLVKEG
ANINAQSQNGFTPLYMAAQENHIDVVKYLLENGANQSTATEDGFTPLAVALQQGHNQAVA
ILLENDTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVQSKMMVNRTTESGFTPLHIA
AHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVKLLLDRGGQIDAKTRDGL
TPLHCAARSGHDQVVELLLERGAPLLARTKNGLSPLHMAAQGDHVECVKHLLQHKAPVDD
VTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRIKVMELLVKY
GASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVV
RCLLRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISARE
GQVDVASVLLEAGAAHSLATKKGFTPLHVAAKYGSLDVAKLLLQRRAAADSAGKNGLTPL
HVAAHYDNQKVALLLLEKGASPHATAKNGYTPLHIAAKKNQMQIASTLLNYGAETNIVTK
QGVTPLHLASQEGHTDMVTLLLDKGANIHMSTKSGLTSLHLAAQEDKVNVADILTKHGAD
QDAHTKLGYTPLIVACHYGNVKMVNFLLKQGANVNAKTKNGYTPLHQAAQQGHTHIINVL
LQHGAKPNATTANGNTALAIAKRLGYISVVDTLKVVTEEVTTTTTTITEKHKLNVPETMT
EVLDVSDEEGDDTMTGDGGEYLRPEDLKELGDDSLPSSQFLDGMNYLRYSLEGARSDSLR
SFSSDRSHTLSHASYLRDSAMIDDTVVIPSHQVSTLAKEAERNSYRLSWGTENLDNVALS
SSPIHSGFLVSFMVDARGGAMRGCRHNGLRIIIPPRKCTAPTRVTCRLVKRHRLATMPPM
VEGEGLASRLIEVGPSGAQFLGKLHLPTAPPPLNEGESLVSRILQLGPPGTKFLGPVIVE
IPHFAALRGKERELVVLRSENGDSWKEHYCEYTEDELNEILNGMDEVLDSPEDLEKKRIC
RIITRDFPQYFAVVSRIKQDSNLIGPEGGVLSSTVVPQVQAVFPEGALTKRIRVGLQAQP
MHSELVKKILGNKATFSPIVTLEPRRRKFHKPITMTIPVPKASSDVMLNGFGGDAPTLRL
LCSITGGTTPAQWEDITGTTPLTFVNECVSFTTNVSARFWLIDCRQIQESVTFASQVYRE
IICVPYMAKFVVFAKSHDPIEARLRCFCMTDDKVDKTLEQQENFAEVARSRDVEVLEGKP
IYVDCFGNLVPLTKSGQHHIFSFFAFKENRLPLFVKVRDTTQEPCGRLSFMKEPKSTRGL
VHQAICNLNITLPIYTKESESDQEQEEEIDMTSEKNDETESTETSVLKSHLVNEVPVLAS
PDLLSEVSEMKQDLIKMTAILTTDVSDRAGSIKVKELVKAAEEEPGEPFEIVERVKEDLE
KVNEILRSGTCTRDEGSVPRSQSEKELVEEEWVIVSDEEIEEARLKAPLEITEYPCVEVR
IDKEGDVKVEKDSTGLVNYLTEDLKSYVSPHEKKQQTAQEIAGEKCEALAVGRSSENEGK
DAPPGETQSAQKQHKPSLGIKKPVRRKLKEKQKQKEENIQGSTEKSELKKCSSEESLDED
TGLAPEPLPTVKATSPLIEETPIGSIKDKVKALQKRVEDEQKGRSKLPVRVKGKEDVPKK
ITHRTHPAVSPSPKSERHGPASPSSKTERHSSLSASTKTERHPPISPSSKTEKHSPVSPS
AKTERHSPVSSSKTEKHSPVSPSTKTERHSPVSSTKTERHPPVSPSGKMDKRPPVSPSGR
TEKHAPVSPGRTEKRLPVSPAGRMEKHPPVSTSGKTEKHLPVSPSGKTEKQPPVSPTSKT
ERIEETMSVRELMKAFQSGQDPSKHKTGLFEHKSAKQKQPQEKGKVRVEKEKGQMPTQRE
TQKTESHTIKRGQRFVVTGVTESKRAVRASSIGLKREEVAVEKEKVLGHKTPEPVQSAPE
EESHKESEVPKEKLADEQGDLDLQISPDRKTSTDFSDVIKQELEDNDKYQQFRMSEETEE
VQLHLDQVLTSPFNTTFPLDYMKDEFLPALSLQSGALDGSSESLKPEGVAGSPCGSLMEG
TPQISSEESYKHEGLAETPETSPESLSFSPKKNEEQIGEISEPTKLEAPTEIRSEKEHPS
IKDITDGSEEQGALVTEGTEPSAECLLKETTLEPSKDTCPKQEDDSLGSCSVLAKETPKE
LPEEASSDEGQLKYGGSAHKTQTDTEAQKSTTTEPSDETKSSPLPDASVKTGTGTESKPQ
GVARSPQGLELALPSRDSEVLSPGADESFAVSHRDSLEASPVLEDNSSHKTPDSLEPSPL
KESPCRDSLESSPVEPKMKAGVLPSHFPLPAAVAKTEIFTEVASMRSRLLRDPDGSAEDD
SLEQTSLVESSGKSPLSPDTPSSEEISYEVTPKATDTSTPKPAVIHECAEEDDLENGEKK
RFTPEEEMFKMVTKIKTFDELEQEAKQKRDYRKEPKQEESSSSSDPDADCLAGVDEPKHM
ESVEDESNVPVVVTSESRKASSSSESEPELAQLKQGADSGLIPEPVIRVQPPSPLPSSID
SNSSPEEVQFQPIVSKQYTFKMNEDTQEESGKSEEEKDHEPHIPEDSHTISSSGPDTSYD
DLNRCADQPEVCDGHGCEAGSPSGSVTPVSSGLRSPTGGEMNEQLVIHKESLPLQDTDDK
NTEEEELNVSRVESLQVDCPSESSSSLSSFPHCPASEGKELDEDIASPSSSKGEDTKTDQ
EFENSPKDYSTQDSSITTQTDKLSMDVPVSDPAETDEIYDPQIISPYENVPSQSFFSSEE
SKTQTDAGHTSFHSSEVCSVPIKSSVEDVVETSSSSGTISSEESNFENQNMEKESKQEST
LWEPQSEKGPSSLEPSIPNTAAVVGEQISKVIITKTDVDSDSWSEIREDDEAFEARVKEE
EQKIFGLMVDRQSQGTTPDTTPARTPTEEGTPTSEQNPFLFQEGKLFEMTRSGAIDMTKR
SYADESFHFFQIGQESREETLSEDMKEGSPAAEPPQRETSAESLALSESKETVSDEADLL
PDDLSEEVEEIPASDAQLNSHMGNSASTEISTEEAPSVGAEDLPTMHMGDMPPKSSVKHT
SCPDSPEPVIQVQLDFSTVTRSVYSDRDDDSPDSSPEEQKSVIEIPTAPMENVPSTESKS
XXXXXXXRTIPTSATEPPSLEYENSLSEDFLPSLDEESKEDETKPKSKIPVKAPVQRVEQ
QLSHLDSSLQKTVAPQGQDMTSRAPDSRSKSESDASPLDSKTKCPVKTKSYTEAETESRE
RAEELELESEEGAARPKIFTSRLPVKSKSNTSSCKGAVSPTKESKEHFFDLYRNSIEFFE
EISDEASKLVDRLTQSEREQELVSDDESSSALEVSVIENLPPVENEHSIPEDIFDTRPIW
DESIETLIERIPDENGHDHAEDQQDEQERIEERLAYIADHLGFSWTELARELDFTEEQIH
QIRIENPNSLQDQSHALLKYWLERDGKHATGRWETVCKKRSARMDIVHLMEASTEPLQER
ISHSYAEIEQTIALDHSEGFSVLQEELCSAQHKQKEEQAASKESESCDHPPIVSEEDISV
GYSTFQDCIPKTEGDSSATELFPQTHKEQVQQDFSGKMQDLPEESSLECQQEYFVTTPGT
EVSETQKPTAISGSQSKTPEEISTPPEEERPHLQTPTSSEQGDSPIVQEPEEPPEHKEES
SQKTSLVIVESADDQPQALERFDADAAFHKGDDMPDIPPETVTEEEYIDEHGHTVVKKVT
RKIIRRYVASDGTEKEEVTMQGMAQGPISIEEGDGYSKVMKRIVLKSDTEQSEVRSSDSP
T
Download sequence
Identical sequences ENSFCAP00000019067

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]