SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000019508 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000019508
Domain Number 1 Region: 555-680
Classification Level Classification E-value
Superfamily PH domain-like 6.16e-19
Family Pleckstrin-homology domain (PH domain) 0.017
Further Details:      
 
Domain Number 2 Region: 82-249
Classification Level Classification E-value
Superfamily ARM repeat 0.000000225
Family HspBP1 domain 0.081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000019508   Gene: ENSFCAG00000024946   Transcript: ENSFCAT00000025627
Sequence length 734
Comment pep:known_by_projection chromosome:Felis_catus_6.2:A3:14552661:14578864:1 gene:ENSFCAG00000024946 transcript:ENSFCAT00000025627 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPPPSDIVKVAIEWPGANAQLLEIDQKRPLASIIKEVCDGWSLPNPEYYTLRYADGPQLY
ITEQTRSDIKNGTILQLAVSPSRAARQLMERTQSSNMEARLDAMKELAKLSADVTFATEF
INMDGIVVLTRLVESGTKLLSHYSEMLAFTLTAFLELMDHGIVSWDMVSITFIKQIAGYV
SQPMVDVSILQRSLAILESMVLNSQSLYQKIAEEITVGQLISHLQVHSSNQEIQTYAIAL
INALFLKAPEDKRQDKHLNPLDLPVTDMANAFAQKHLRSIILNHVIRGNRPIKTEMAHQL
YVLQVLTFNLLEERMMTKMDPNDQAQRDIIFELRRIAFDAESDPSNVPGSGTEKRKAMYT
KDYKMLGFTNHINPAMDFTQTPPGMLALDNMLYLAKVHQDTYIRIVLENSSREDKHECPF
GRSAIELTKMLCEILQVGELPNEGRNDYHPMFFTHDRAFEELFGICIQLLNKTWKEMRAT
AEDFNKGLRSGREQITRALPSKPSSLDQFKSKLRSLSYSEILRLRQSERMSQDDFQSPPI
VELREKIQPEILELIKQQRLNRLCEGSSFRKIGNRRRQERFWYCRLALNHKVLHYGDLDD
NPQGEVTFESLQEKIPVADIKAIVTGKDCPHMKEKSALKQNKEVLELAFSILYDPDETLN
FIAPNKYEYCIWIDGLSALLGKDMSSELTKSDLDTLLSMEMKLRLLDLENIQIPEAPPPV
PKEPSSYDFVYHYG
Download sequence
Identical sequences ENSFCAP00000019508

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]