SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000024096 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000024096
Domain Number 1 Region: 491-928
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 3e-115
Family Reverse transcriptase 0.0000000000214
Further Details:      
 
Domain Number 2 Region: 122-248
Classification Level Classification E-value
Superfamily Retrovirus capsid protein, N-terminal core domain 4e-46
Family Retrovirus capsid protein, N-terminal core domain 0.0000132
Further Details:      
 
Domain Number 3 Region: 358-455
Classification Level Classification E-value
Superfamily Acid proteases 1.48e-23
Family Retroviral protease (retropepsin) 0.0065
Further Details:      
 
Domain Number 4 Region: 1131-1225
Classification Level Classification E-value
Superfamily Ribonuclease H-like 1.04e-20
Family Retroviral integrase, catalytic domain 0.0084
Further Details:      
 
Domain Number 5 Region: 312-349
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000000000344
Family Retrovirus zinc finger-like domains 0.0011
Further Details:      
 
Domain Number 6 Region: 969-1038
Classification Level Classification E-value
Superfamily Ribonuclease H-like 0.00000000152
Family Ribonuclease H 0.0097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000024096   Gene: ENSFCAG00000026054   Transcript: ENSFCAT00000027268
Sequence length 1227
Comment pep:novel chromosome:Felis_catus_6.2:B3:78991674:78995660:-1 gene:ENSFCAG00000026054 transcript:ENSFCAT00000027268 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PPSWLKPFLAPLPPEPKPILALQGTKKKENKSLTQTSAPFYPVLQGGTEEELIFPPPYNP
SRMPEEHHPPPPGEADAVLRAGGGNAPVGSPPLTRQRAQREQSTSAADSTILPLRATGPP
DAEGNQPHHYWPFTTSDLSNWKAQNPKFSEKPAGLIDLLDSVLFTHQPTWDDCQQLLQVL
FTTEERERILNGDRKLLPGADGNPTTNQAQIDASFPLTRPQWDFNMAEGKERLWVYRQTL
MGGLRMAAEKKSAGLTGGSRKEPPEDKQARAMAATSSKQTRDLARILLATTADSPEERDR
RLRQLADDARKGKETTKGGKQRLQKDQCAYCKEIGHWARDCPKRAGGKGSRGSDPLPEPR
VTLKVEGTPVDFLVDTRAQHSVLRTPQGKLDSQKSWVQGATGMSQYSWTTRRTVDLGTGW
VSHSFMVIPECPYPLLGRDLLTKIGAQITFRGGPQVTDGKDHPIQVLTMKLEDEYRLHQE
VLPREDNIDRWLQEFPPVWAETGGIGLAAHRTPVLVELKPGESPVRIKHPMSQEARKGIQ
PHIQRLQSLGVLVTCQFPRNTPLLPVKKPHTNDYLPVQDLREVSKRVMDIHPTVPNPYTL
LSSLAPSRVWYTVLDLKDAFFSLPLAPQSQPLFAFEWHDPEKGYSGQSPTQLPQGFKNSP
TIFDEALHEDLGEYRREHPGLSLLQYVDDILIAANMAKDCERGTQDLLATLGALGYQASA
KKAQICRERVSYLGYILEGEQRRLSDARRETVLKIPTPTSRREVREFLGSAGYCRLWVPG
FAEISRPLYEATKEGKTFKEETAFNQLKKALLSAPALGLPDIMKPFHLFVDEHEGIAKGV
LTQALGPWNCLVAYLSKKLDSVAASWPPCLRIIAVTALLVKDADKLTLGQEIWIMTPHAI
EGVLKQPPDRWMSNTRMTHYQSLLLNPPRVRFHPRAALNPATLLLDPDLGASQHDCVGIL
EQVHGFRTDMTDRPLPDAEATWFTDGSSFVRDGHRYAGAAVVTKKDTVWVEALPSGTSAQ
RAELIALTKALTLGARKWLNNYDLGDPVLPDQPKYSQEELQRIKKLPMAQKIKGWWYTPN
KEIVLPDWLGVSILELRNQDSPQDTKIEQAVSACKTCQLTNSRATSNKKGTRFRGTRPGA
QWEVDFTEVKPGKYGYKYLLVFTDTFSGCMEAYPTKHETAQMVAKKLLEDILPRYGFPAM
VGSDNGSAFISQVTQAVAKAVGANWKL
Download sequence
Identical sequences ENSFCAP00000024096

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]