SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for FGSG_06962T0 from Fusarium graminearum

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FGSG_06962T0
Domain Number 1 Region: 1-99
Classification Level Classification E-value
Superfamily Pre-PUA domain 5.89e-35
Family Nip7p homolog, N-terminal domain 0.0000664
Further Details:      
 
Domain Number 2 Region: 100-175
Classification Level Classification E-value
Superfamily PUA domain-like 1.71e-24
Family PUA domain 0.00025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) FGSG_06962T0
Sequence length 188
Comment | FGSG_06962 | Fusarium graminearum 60S ribosome subunit biogenesis protein NIP7 (189 aa)
Sequence
MRPLTEKETQTLFEKLANYTGGSLKNLIAPLDDSPNADRYVFRLVRDRVFYVRLSIANLA
TSIAREKLLSLGTCLGKFTKTGKFRLHVTALPIIAEHARYKIWVKENGTMPFLYGSNIVK
AHVGRWSEDCPEHQGVVVYSMNDTPLGFGVTARSTAEARRLDPTGITCFRQADCGEYLRD
EDNLFATG
Download sequence
Identical sequences A0A2H3G4M3 V6RGN5
XP_011326639.1.100342 5518.FG06962.1 FGSG_06962T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]