SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for FGSG_07538T0 from Fusarium graminearum

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FGSG_07538T0
Domain Number 1 Region: 8-328
Classification Level Classification E-value
Superfamily beta-lactamase/transpeptidase-like 5.63e-58
Family beta-Lactamase/D-ala carboxypeptidase 0.000000201
Further Details:      
 
Domain Number 2 Region: 438-536
Classification Level Classification E-value
Superfamily D-aminopeptidase, middle and C-terminal domains 1.88e-43
Family D-aminopeptidase, middle and C-terminal domains 0.0000747
Further Details:      
 
Weak hits

Sequence:  FGSG_07538T0
Domain Number - Region: 354-430
Classification Level Classification E-value
Superfamily D-aminopeptidase, middle and C-terminal domains 0.000366
Family D-aminopeptidase, middle and C-terminal domains 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) FGSG_07538T0
Sequence length 536
Comment | FGSG_07538 | Fusarium graminearum conserved hypothetical protein (537 aa)
Sequence
MPVSKQIVEDILKTIPSRIRGPGGAIAVLSDSALVDHRVWGYADFNRRIPMTPEVQIPIC
SISKQMLCALVVDLERNPTPALKAKGDVKEQFETKLKELLPELAKTGKLKLDDLCNNRSG
IRDYWAITLLWGAKPEDRYSLADHNGPMLDSLKSFHFEPGTEYSYSNTNFNIVGRVVEAC
TGESLASLLNERIFKPAGMKTAELCADSAKLPPPCVGYEGDELRGYIPAENRIEWAGDAG
IIASLTDMIAYESFLDRSVFDPESWYRKIFQPSTFSDGVPSTYAQGLAHTEIGSVGAIGH
GGALRGYRLYRAHVPEERLSVVVMFNHEADAATLSEYIIQNILGLQKPMAPALVDASPTW
PGVYLDEGTQLVITVTLGQKGQVLVTYANYVEPVKLTDPERGESKGMAAVINGDILRIQR
LKENRAITAKRLTLGTIAIDSSPIEGDFYSPEINSTFHCVNQGGLVFGTFDGFLGQSPAQ
FMRYLGDDVWALANPRGMDAKPPGDWTVVFRRDDKGTVVGLTIGCWLARKIEYVRK
Download sequence
Identical sequences I1RTM7
5518.FG07538.1 FGSG_07538T0 XP_011327315.1.100342

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]