SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for FGSG_05208T0 from Fusarium graminearum

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FGSG_05208T0
Domain Number 1 Region: 760-1022
Classification Level Classification E-value
Superfamily Tropomyosin 0.00000000458
Family Tropomyosin 0.0014
Further Details:      
 
Domain Number 2 Region: 607-750
Classification Level Classification E-value
Superfamily Tropomyosin 0.0000000174
Family Tropomyosin 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) FGSG_05208T0
Sequence length 1095
Comment | FGSG_05208 | Fusarium graminearum conserved hypothetical protein (1096 aa)
Sequence
MSAYAREGSPYGFDSSRMSPTATSPRGKTFVEGYRNEIINGFEKDNGLYNPMNPERPQSS
ALVDLRDPIQVHLLTETALSDSKEYEILSQEEVDDLKKQCQSLSQRVDSTRQNLTIQSKY
RDAAISMARLYNPGKLEGKRRSLLGRNSSDQARAKEAETERQASERKCEELAAELFNLEK
RLMEPRRRLLEHTAGILQLTHKASNKKKDMTPTLHPMNGMPGSPESLYTYTRNSMDRAGD
EHFFHDDNQFDQANGISTRGPPRQQAIEIPLKSPIREQHSQLKELEKIKDENLLLKGQSD
SLVTSITEMEARLENLNGSLRDAIVRFNPSKNEDYYDPPFGVPGMKPGELLNNQMDYLEM
GLNAIEVEQEESSGDQGKVDGSTEKRIESLNQQVRDLLMTVDPEYPAAPQSSQDTVESKL
AYLEDALRAADSELERAIQVARSGPPEKQDDEQVERILMNLWNMMQTGFTKIKKEKEERR
RTRIERGYEDEEVSDDEFDIDEAFSLPGFSNRVQWLYSQTTTLANQKSILKRQIKQQREL
NNKSDAEKDEELARKQEELDETQVLLARAERDASTAHAMLEQTLEQLEGTGVARNIGAQK
AASEESTKKIDELESELKRLQSDLAGAAGAAGAAHAQVEDRENKIDSLEKELDNVRSDLA
NATAAAAAAQAQIDDRESKITALESELAYLETAQSEVEERNRKIAALESELEQANAAHTQ
IEERDAKLATLRTEIQEANTFKDQVEVHSATIATLKAELEKTNDIEARLEERNARVARLE
SDMELLQTDLAGAAGAAGAAQGQLEERNSRIAALEADVKQLEEKLADAESSSNNNRNQLT
GVDSVIDALSAQLDEVNRSKQMAENNARSLQQRVDGQKDELAAKKKQLKEKEDELELLNM
NFVETKTELTIAQAELDGAYGSRAERAADVAAIKTSGEVMKLQNQLTRLKNELAGTVQEL
EDVTKETLSAEREKIELENNLHDVQIVKRQLEGEVATLRKRLEADMEKAREHITKLQEDL
DSERLRAIPPNGGVGRGASVLSEQFRATMREERKKFQDNIKEERARTRQLEEELAKLKRV
PTPIPTPTKAPLSPQ
Download sequence
Identical sequences A0A2H3HP19 I1RML6
5518.FG05208.1 FGSG_05208T0 XP_011323717.1.100342

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]